GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:45:49

Sequence CD1B_1 : 5879 bp : 41.64% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    981   1220  240  2  0   57   63   153 0.678   7.62
gcagctgggagggggagaaactaagtgaggtggataaactaaaagcatccttctgggtta
aagcagactaaaagcttagcaattgcttaatatcaccatcttatcctatagatgtgggaa
taaaggctaaggaaggagaaatgaaaatgcagaatcatatgggggcttttccaaggaggt
ATGAAGGAAGGTGAGGACAGGGAGAGCGGCTGGAAGTCAGGGGGTAAGAGAAACTCTAAA
AATCAGGGCTTGAGGGAAATAAAAGGTGAGGTAAGAGGCTCAGGGCTGTGGGAGGCACAT
TTTTCTCTGAAAAGCAGTTTGGATGAGGAAGAGATTTGGCAGTTGGAAGAGAGAAGAAGT
CACTACAGGGTACTGAGGAAAAGCTTTGCTGAAATTGGAGATCAAATACCAGCTCTGCCA

gtaagaagttgcatctcccagtgaaatgctgctgctgccatttcaactgttagctgttct
ctttcctggtggtaacagtgaacatggtaagagtcactctggcagctcccagcactggtg
caggggtttggattttaaaaagcaagcagggctttcctaggtgcaattggacactaaggg

 1.02 Intr +   1642   1873  232  0  1   88   82   212 0.796  17.02
gccttaaggcagtcaaatgtgtcagacttcctgtgttctttagactctaggttcttgttt
tctaaatcattttcattcccattcttcctaattgtctcctgcttctctctttatcttcac
catcttgcttttccactcttcacagccttccaggggccgacctcctttcatgttatccag
ACCTCGTCCTTTACCAATAGTACCTGGGCACAAACTCAAGGCTCAGGCTGGTTGGATGAT
TTGCAGATTCATGGCTGGGATAGCGACTCAGGCACTGCCATATTCCTGAAGCCTTGGTCT
AAAGGTAACTTTAGTGATAAGGAGGTTGCTGAGTTAGAGGAGATATTCCGAGTCTACATC
TTTGGATTCGCTCGAGAAGTACAAGACTTTGCCGGTGATTTCCAGATGAAAT
gtgagtctagtccaccgaactgggaagagtctcaaggactctcttttctctcttttttgc
aaagtgttgctctctctgatgcttctcccttcctttctattttacccaaatgcacgcaca
tgcttttcttgagtagtctctcactccagcttcacaccatcacacctcatatttcagatt

 1.03 Intr +   2539   2817  279  2  0  110   96   193 0.999  18.83
cacatttttctcaatgctcttgtttctgaaaatgtctaaatgttatcattagtttttagc
tcatcatcattttacaccaaataactttatccccaccaaaatctaaaatcctaggttctt
ttctcatgcctttttttcttatttgtgtttaataacttgctctcttttccctctacatag
ACCCCTTTGAGATCCAGGGCATAGCAGGCTGTGAGCTACATTCTGGAGGTGCCATAGTAA
GCTTCCTGAGGGGAGCTCTAGGAGGATTGGATTTCCTGAGTGTCAAGAATGCTTCATGTG
TGCCTTCCCCAGAAGGTGGCAGCAGGGCACAGAAATTCTGTGCACTAATCATACAATATC
AAGGTATCATGGAAACTGTGAGAATTCTCCTCTATGAAACCTGCCCCCGATATCTCTTGG
GCGTCCTCAATGCAGGAAAAGCAGATCTGCAAAGACAAG
gttagtcctgctgttatttcacttcccaccacctcctctaagatcaagagtaggaagata
tcaaaggataggagcttaaataacaagttatttggttcccaaaggagtgaatggggtcgc
tgtccaagcttgtaggtttctgagttcataacctctgaactcgagttataacatgacact

 1.04 Term +   3021   3310  290  1  2   97   43   259 0.934  16.85
tcccaccacctcctctaagatcaagagtaggaagatatcaaaggataggagcttaaataa
caagttatttggttcccaaaggagtgaatggggtcgctgtccaagcttgtaggtttctga
gttcataacctctgaactcgagttataacatgacacttttttttctccttcctgccttag
TGAAGCCTGAGGCCTGGCTGTCCAGTGGCCCCAGTCCTGGACCTGGCCGTCTGCAGCTTG
TGTGCCATGTCTCAGGATTCTACCCAAAGCCCGTGTGGGTGATGTGGATGCGGGGTGAGC
AGGAGCAGCAGGGCACTCAGCTAGGGGACATCCTGCCCAATGCTAACTGGACATGGTATC
TCCGAGCAACCCTGGATGTGGCAGATGGGGAGGCGGCTGGCCTGTCCTGTCGGGTGAAGC
ACAGCAGTTTAGAGGGCCAGGACATCATCCTCTACTGGAGTAAGAAATAG
cagggacccaggctggaaatgccaggaagtgatcttcaggcatagagggaggcactgggg
aaggatagagcttgagagatgaaagagggagagattgattgattgatttccctgacccca
atcccaacaggagtaaaaatagataatccaagttatcaaaaatgtaggaattaaggacct

Predicted peptide sequence(s):


>CD1B_1|GENSCAN_predicted_peptide_1|346_aa
MKEGEDRESGWKSGGKRNSKNQGLREIKGEVRGSGLWEAHFSLKSSLDEEEIWQLEERRS
HYRVLRKSFAEIGDQIPALPTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWS
KGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFL
RGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVL
NAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGD
ILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWSKK