GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:14:40

Sequence CASP9_1 : 34393 bp : 48.91% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1296   1427  132  2  0   96   85   306 0.953  29.24
actcctgggggcggggcgaggccttggagatgcgtccggaggcggtggggagcgaagact
gacccggggccgtgacgcgggggcaggccctggggcgggggcgggtcctggggactgggg
cgggcggccgaggcccggaagcggactgaggcggcctggagtcttagttggctactcgcc
ATGGACGAAGCGGATCGGCGGCTCCTGCGGCGGTGCCGGCTGCGGCTGGTGGAAGAGCTG
CAGGTGGACCAGCTCTGGGACGCCCTGCTGAGCCGCGAGCTGTTCAGGCCCCATATGATC
GAGGACATCCAG
gtgcgcccccggccccctgtccccgcgctgcacggccgggtccccacgcccctcgaggag
gcgttgtgcgggagcctagccttccctgtggcttcaaacccctcagcggagccaaagaat
cccaaacacctcttagtcgggtgttcgctaaagcgattccatgccatactcagtcagcgt

 1.02 Intr +   7101   7386  286  2  1   77  123   197 0.984  19.01
ccctgcaaaataatgaacagatcagcaaaggctggtaaatggcacacagtgcacctgcag
ctccattgctgcccacgtgcctgattgtttagacttacagtagctgggaaatggggagac
aaggtgagagccatataaaagtacgtggataattagtatcctgcctttctttccaaacag
CGGGCAGGCTCTGGATCTCGGCGGGATCAGGCCAGGCAGCTGATCATAGATCTGGAGACT
CGAGGGAGTCAGGCTCTTCCTTTGTTCATCTCCTGCTTAGAGGACACAGGCCAGGACATG
CTGGCTTCGTTTCTGCGAACTAACAGGCAAGCAGCAAAGTTGTCGAAGCCAACCCTAGAA
AACCTTACCCCAGTGGTGCTCAGACCAGAGATTCGCAAACCAGAGGTTCTCAGACCGGAA
ACACCCAGACCAGTGGACATTGGTTCTGGAGGATTTGGTGATGTCG
gtaagtagcaagagagtgattggtgggtgggcatgacacgtagtcatttgggactcacta
tgagtacagctgggtgggctgagattcagaatttaattttagcattgtctttctgaatgt
tcatagggatggcaaaattctgggaggttttcaggaggttgaatcttggcagcccctcct

 1.03 Intr +  17589  17623   35  1  2  128   97    -9 0.758   1.94
gtgtgtgtttaactttgttagaaacctctaaacagatctccaaggtggctctcccaccag
cagagtctgagggtctgagttctcgctgctccgttcttggggggctgtcctcacagagcc
ccttgcccctcctctgctgtaacccaacattcatgtttctctctttctctgcctcttcag
GTGCTCTTGAGAGTTTGAGGGGAAATGCAGATTTG
gtgagtctccatgaaatttgggccagtagctcgggctctgggcccttccctccccacccc
tcaggtccttccctgcaggtgtgtcaggagcccagggaacccaaccctaggcagtgcagt
gggggtctggtctcagcctccctgactccggcccagcgcctgctggggcagattgttcat

 1.04 Intr +  18421  18597  177  0  0   57   81   287 0.832  25.02
ggggtcaccttctagtgctagtcttccctgcagttgcttctcttttgccctggaatgccg
ggtggagaccctgctactccttgtgcgagagggcagaccccgttttcttcccgcctctcc
agactgtcctctagggagcgtggggagagcccgggtttacgtgggtccctgtgctggcag
GCTTACATCCTGAGCATGGAGCCCTGTGGCCACTGCCTCATTATCAACAATGTGAACTTC
TGCCGTGAGTCCGGGCTCCGCACCCGCACTGGCTCCAACATCGACTGTGAGAAGTTGCGG
CGTCGCTTCTCCTCGCTGCATTTCATGGTGGAGGTGAAGGGCGACCTGACTGCCAAG
gtacactcactatctgtggagggagacagggtggggggcagtgggtggggaagtatcttt
tgagggactccaaaagccagctgactccccaggcgagcccttacatctggaggaccatgg
gaggtaggacggcccagcggctacaggttcaagttcagacgcagaagtccgggtttgagg

 1.05 Intr +  19417  19506   90  0  0   58   91   105 0.996   7.99
ccaggctggtctcgaactcgtgacctcaaatgatccacctgccttggcctcccaaagtgc
tgggattacaggcgtgaaccaccatgcctggccaggctgggcccttttattgttaggaac
ggtccagtctgcatctagacctatccgtgcttctggctcacctgcagccctctcttgtag
AAAATGGTGCTGGCTTTGCTGGAGCTGGCGCAGCAGGACCACGGTGCTCTGGACTGCTGC
GTGGTGGTCATTCTCTCTCACGGCTGTCAG
gtaggaagcctcccactgttccctgggcaggcattgggtactggccgtgccaagaggctg
tgcaggggccatgtcccttcttgtgtccaaaacacccttggctttgtggaaaagggctgt
ggggccctgcccacctcctgttgttttcttgggagccatgtggtcctctgaggagttggc

 1.06 Intr +  20738  20885  148  1  1   68   86   140 0.969  11.61
tcaaggtgtctttccagatgctgaccagggtctttccagaaccaacctgctctgtctcaa
tcagcctcgtgcccctggctttgaccttccaaatccttggctcccacaaaacctctgaac
aggctgttggattcctactccaacttcttggttttgtaaccagggttcttggtcttctag
GCCAGCCACCTGCAGTTCCCAGGGGCTGTCTACGGCACAGATGGATGCCCTGTGTCGGTC
GAGAAGATTGTGAACATCTTCAATGGGACCAGCTGCCCCAGCCTGGGAGGGAAGCCCAAG
CTCTTTTTCATCCAGGCCTGTGGTGGGG
gtaagcagctcctcagcctccctctgggtgggtctggtggggagggagccgccacctgct
tctttctccagcctgcccctcacagggcccatgaggtctctccaggcagtcagagggtac
cacacatggtccctttttggcagcacctctgtctggctggagcaggccctgctctgtctg

 1.07 Intr +  30044  30223  180  0  0   71   99   157 0.995  14.94
gcaggtttgcgtgacccagttcccagcttgacttttccgtttggcttaatgagtttgggg
tcccaagatttattttcctttcacactgttaatgtagtatattgcaccgactttcatatg
ttgaaccatccttgtctgtgtatttcaatgacaagaggtgtttgtttctgcttcctgcag
AGCAGAAAGACCATGGGTTTGAGGTGGCCTCCACTTCCCCTGAAGACGAGTCCCCTGGCA
GTAACCCCGAGCCAGATGCCACCCCGTTCCAGGAAGGTTTGAGGACCTTCGACCAGCTGG
ACGCCATATCTAGTTTGCCCACACCCAGTGACATCTTTGTGTCCTACTCTACTTTCCCAG

gtgagcacatcagaagggctcgtcctcgcagccagtgggtcttcccgtctgccctagagg
cagctgtgtggtgagagaaaagaccagggtatgagtcctggttctgtcttttgcccctct
gtgaccctgagcaagttacttctctctgagcctcggctcaggctgagcgggcaaggatgc

 1.08 Intr +  31495  31604  110  2  2   81   96    75 0.966   7.60
catgagggtgaaataagatcatgattagggcagagcctcaggggccaggctgctcctgtt
ggatgtatgtatgagtcaaggtctggagggcgcccgagccagcgtgcatggccagagggg
tggtggggagccggcggaggggtggctctccagcagtgttcagccctcctccctccaaag
GTTTTGTTTCCTGGAGGGACCCCAAGAGTGGCTCCTGGTACGTTGAGACCCTGGACGACA
TCTTTGAGCAGTGGGCTCACTCTGAAGACCTGCAGTCCCTCCTGCTTAGG
gtgagtgctgccttcctctgcaaaggagaggggaggctgctgaggggcagcgtgtcctcc
tggggctggggatttggggtgagcagggcaggcccaaaccaagggtaaaaggtagtagac
tcctgcctctgagccttggagtcggcacttttgtgtctctttatgagaggcatcctgcct

 1.09 Term +  33465  33569  105  2  0   91   47    23 0.146  -3.09
cttttgcttttttcgaaacatttccccatgtttttctggggtctcgctatgttgcccagg
ctggtctcaaactcctgggctcaagtgaccctcccaagtagctcttactacaggcgtgca
ccattgcacccagccccatttattcatgtcttatttcacttgatccttatcccatcccag
GAAGGCAACAAGGGTGAGAACCCTGTGCTCAGGGAGGTTAGGTCTCTTGTCCAAGGGAAA
ACGATTATCCAGAGAAGAGACCTGGCCAGAACCTGGGTCCCCTGA
gtcctagccatgcttcccatgtgccttacttgctgaagcacccccggactgcagtgtgaa
cgtgctgtgcaatagtgacacgctgggcttccccacaaggctccaccctgaggtctttta
agctgtccttatgccagcctatttcttgttttttgggcctttttttttggagatagggtc

Predicted peptide sequence(s):


>CASP9_1|GENSCAN_predicted_peptide_1|420_aa
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLREGNKGENPVLREVRSLVQGKTIIQRRDLARTWVP