GENSCAN 1.0	Date run:  7-Jan-104	Time: 14:54:19

Sequence KCNAB2_1 : 76543 bp : 56.00% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.09 Intr -    907    446  462  1  0   16   94   376 0.383  24.93
 1.08 Intr -  10342  10262   81  1  0  107   20    62 0.024   1.63
 1.07 Intr -  14122  13912  211  0  1   74   49    85 0.440   2.64
 1.06 Intr -  14755  14566  190  2  1   49  105    84 0.786   5.36
 1.05 Intr -  14987  14914   74  1  2  107   -5    69 0.452  -0.96
 1.04 Intr -  16129  16037   93  0  0   73   81    89 0.962   6.28
 1.03 Intr -  16282  16210   73  2  1   81   47    78 0.792   1.96
 1.02 Intr -  16773  16625  149  2  2   52   71    72 0.349   2.29
 1.01 Init -  17258  17167   92  2  2   53   48   100 0.627   2.42
 1.00 Prom -  21045  21006   40                              -5.11

 2.01 Init +  26418  26635  218  2  2  101   99   282 0.281  28.75
ccaggggccgggtcccactcctagacaccaagacctggtggtggcactagttaaaggatg
tttcgctgcagctgccccctgccccagggccagccatccagcctggggcacgtggggcat
tggcacactgtctaactcatcaccgtctggacagtggcagctcccaagccaggcggcacc
ATGCTGTCCATGACGTACAGCGAGAGTCTGCGGAGCGTGAGCAGCAGGTGCCACTCTGAA
TGGGCCCTGCACCCCGTCCGCCAGACGGACACGCTGGAACTGCAGCGGCTGCGGGAGGTG
CGGGCGGCTGCCCAGGCCAGGAACATGGAGAGCTTCCTCCGCATGCACGGCCTTTCCCTG
GACGGCTGCACCGCCCAGCGCACAGGCATGAAGTATCG
gtaagggccgggcaggggggcggtggggtgggaagtctgatttcagccatataaatatgt
ataaaagggctgggcacggtggttcacacctgtaatcccagcacttggggaggcagaggc
gggtggatcacctgagatcaggagctcgagaccagcctggccaacctggtgaaacaccac

 2.02 Intr +  32156  32286  131  2  2   81   89     7 0.005   0.94
gtctcgttcgggctgcatcctagatggtgggaagacaggactgactggaagctggtctga
ggctctctctgcagtccagatgtggatggcagggagcctctgcggtccttgggcactgac
ccttggtcatgaactcctggcagggcaggagtcctgatttcctgtgctttctgactctag
ATCCCAGGCTCTTACCACAAGCTCAGGTTCACCAGGAAGTACTTGGTTGGTTGCCAGGTT
CATTGAGCAGACTGTAGTTGCTCAGTTAACCATAGGCCATCACTTCCAGCTGGGAAGAGC
TGGGAATCCAG
gtgtgtcttaaaggacaggcgggaaggagggcactgagggcaggaggaggggaaggagaa
aaacagcagagaccaggggggatggcaagttaacctgtctacaaggccaagtgcatcctg
ggaaagaggggtccccaaggaacggggtccatcttgggaaagatcctgttttactttcct

 2.03 Term +  33308  33399   92  0  2   57   43    72 0.003  -2.22
ttgtttccaaataaagtcacactcacaggtatcaggaattaggatctcaactgtcttttg
gggacacatttcgacctgccacaggccccaaggattgactcaacaccttgagcctgcggg
gacatccctgagtgtcctgggaggaacccgggctcccaccggctacctgtgtgacctcag
ACAAGTCCCCTGGCCTCTCCATGACTCGATTTCCTTACCCGGAAAGTGGAGACCGGGGTC
ACTACAGCAGAATTGTCCTGAGGACTAAATAA
gctccaggtgacataactcaaagctccaggcttggctcattgtgggagagaaatgcaggc
ccttcccgtccctggaaaagggaccttcccacacagcagtcgctgtccaggcacctggac
tgtcccctgtctatccatcttggggtctcactcgtgcacctagtctcacttagagatgta

 3.05 PlyA -  37383  37378    6                               1.05
 3.04 Term -  38776  38621  156  1  0   56   45   123 0.981   3.05
 3.03 Intr -  39746  39639  108  2  0  106   64    43 0.853   4.68
 3.02 Intr -  40646  40559   88  1  1  129   68    -9 0.967   1.67
 3.01 Init -  41070  40805  266  0  2  125   36   215 0.958  14.48
 3.00 Prom -  42282  42243   40                              -6.70

 4.01 Init +  46941  46990   50  2  2   93   51    79 0.461   3.10
gccgcgtagggctcctcctgccgcgtagggctcccgggaggatccggggacaggatgcct
ggggactgcctggcctgctgcaaccctgcaggctcctaggcaacctgtgccaggacatac
gggcatgccggtcctcagcagagggctgccaccctccttcacctcctaaggacagtcatg
ATGGCCCAAGGCCTGTTCCTGTGGACCCTGGGATGCACCACAGTGGGCAG
gtgcctcagtggccccgggaaggagcccgggcagctgtgcttggttaggaggcctacgct
gccaggctctgccgctgctgttgggcctggctgtggctgtaacaaaggaagggctggcct
tgcttgagaactggcagccctaccatggagctccccgcaccccgagggacagatgcacag

 4.02 Term +  48235  48400  166  1  1   89   44   127 0.298   6.10
ggatttggccctttttcctctcctgtcagatacaaggcctgtttccagaatgtgcagtcc
ccacctcccctctgcatgcagtacacacacccccacacacacaccgcccactgcagtaca
cacaccccgccccccaccagcacccactgccctgacaccgccctccccgctctgtcccag
CAGGAGCACGCAGACGCGGCTGTCAGACCTGGTGTGTTTTCAGAGAGGCATCCCTTGTGC
CATTTCTTGCGGCATGTCCTTGGAACTAGAGCTGCCTCAGTACAGCTCTGACCAGCATTT
CAAAAGCCCCAGACCTCCTGGACCCATAGCCAGCAGCCCGCTCTAG
agacttttgtcccctcagtttattgaccccaggagagcaggactttctctgaaggccagc
tgtccacacacactaaggacaccctggccacagagcagcacagagggacacctgtggctg
ccccctgtgccctacagcctgaggtctgagcaccgacgggataatctggcttcctgccag

 5.01 Init +  53621  53778  158  1  2   67   56    92 0.514   3.25
aggccgagtgttggggagaaggggatgcaggggatagagctgggggtcagggtgcagatc
tggtggagactttggctttgaccctctgcgagatggaagcccctggagggcttttgcatg
gaggaaatttgacctgatttaaaaggtctgccaaggctcgccctggctgctgcactggga
ATGGCGAGTCATGAGGATGTCCCAGAGTTCAGCGTGTGCACGATCCCATGTACTCGGAAG
GCACATCCTGATGTGGCAGGGCTGTCGTGGAGCCTGGGAGGCCGCATTTCTGATCTCATG
CTGATGCTGGCCCATGGACCACGCTTTGCCTGGGGAAG
gtgcagggagagaggatggaagcagagagctaggaggctattgtgagaaaccacccaaga
gccgctggaggctcagagcagggtgggcaccgtggaggtggggagacgggtcagattctg
gactaatttgcaggggaagccgcggcaggggctgaacttcaggctccagtgatgggagga

 5.02 Intr +  55992  56274  283  0  1   26   72   139 0.523   4.06
gggcttgttgctggtgaggcccagtgctctgagccgcacctggggaagcgtgacactcag
agggaagcagccctgtccgagagccagaagctcaggggcacctttctctccggcctcttg
gagggagctgtcacttgcagaggggctcccctcgctccatgagtcccaccccacgaccag
TTCTTTGCTCATGGAGCACAATCGCGTCCTGACAGCAGCCATGGAGCAAAGTCTGATGCA
CAGCGCATTTAGCTCGGGCAGTCATTCATCCATCTTGCCCATGAGGCAGCCACCACCACA
GCAGTGCCGCTCAGGGCCGGGAGTATGTGCCGTTGGAGAAACACTGGACAAGAGGCCAGA
ATGGATGTCACCCACCATGCACCAGCTGTGGGATGTCAGTTGCTCCATCTACAAAAATAA
CAATTCAGTCCTCATGTGCAGGTGCTGGGAAAGATTCAATGAG
gtacaactgaatacaccgccctggctttaaggacatagactcatcccagcaacatccaca
gagcccctgctggggactgccttggtttcctaggactgctgtaacaaagtaacataacct
gggggcctgaaacaacagacaccgttctgtcaccttctggaggccagaggtctgatacca

 5.03 Intr +  57076  57155   80  0  2   83   70   151 0.833  11.64
gctgcctccatccctgtcctgtggcaggagagggcaaggagacagcccacaggggagcct
gtcgggcccgggagggcagggcctggacacggggaggcctcccaggccgagagggtggtg
ctccagagcctctgggccccacccccggctggcaggacagtgtcggttttctcgtttcag
ATGGCAGAGCAGCTCATGACCTTGGCCTATGATAATGGCATCAACCTCTTCGATACAGCA
GAAGTCTACGCAGCCGGCAA
gtacgtgtcttttcacacgggaaaaagtggttcagaatgcctgggcagagccggagctac
agggattcctgccgctcgcgttcccaagagtgctcacaaatgcaccttgcaccctgcttt
catttttaaactctgaatggctttaggaggtgctattttcatggggctggaattgcagaa

 5.04 Intr +  62348  62392   45  2  0  134   56    63 0.925   5.71
cgcaccccggctgggcacgtggtacacatcatatgatggagaagtgcccatttcatgccc
caggctcctgggtgggagggctttcaggacctctgtgtgagagatgaggacgtcggggat
gaaggaggaccccccaggggccgggcttatcacaccccttctttctcttctgttccacag
GCGGTCCAGCCTCGTCATCACCACCAAGATCTTCTGGGGCGGAAA
gtaggtgcaacagctggcgatgcttccagccccggcccagcagccacggccccgtgctcc
ccagagacccctgacctagaaggctcctggggtggcgggaggacagtcctccttgagaag
ggagagtggtcggggtctgtcctggacaggccccggcccagtgccatttcctgtccccag

 5.05 Intr +  63889  64091  203  1  2   81   69   100 0.952   6.85
ctgggcctctgggagttcagccctgtagcctcgggtccctacccccaaagtggaatccga
ctccacacggcatttgctgaccctgtttttgcgtctaacattgcatcgtaaacgtttttt
gggaggggccagggtgccaaaaccgctggtgacatcacacgcggtcggcctgttttccag
GGCGGAGACGGAGCGGGGCCTGTCCAGGAAGCACATAATCGAAGGTGAGGACGCGCTCGG
GCACCTCAGGGCCCCCATACCTGTGGGATCATCCTCGGAGGCCAAAGTGATGGCAGCACA
GGGCCCGACCCCCCCAGTTAACCCACTGAGGGCCCAATCCCGGGGCACCCGGTGCTCTGG
CCTGACCTTCTCCTTCCACCCAG
gtagcacagcgggacgctgcagagaacgagggcagcccggtggctgagcacagaccacag
accagcctgggtttcaatccaggtttggccccacactggctgagtgggtcttcagcaggg
gcaccctgccccatgcctctgccacagtatctgtgcaatagggacagtaagagcgcaccc

 5.06 Intr +  65270  65356   87  0  0  108  100   182 0.983  21.84
ctgtgggatgtgcccccacctctgccgtggcatttcacgacctccatcagcttctggaag
cttccagatgccagaggcctcttctccatctcttgttccctgagccgggcatggatgggc
ccaggtgcctgtggagatggagccacagcagtgacgcccccccacctggtcctcccccag
GTCTGAAAGCTTCCCTGGAGCGACTGCAGCTGGAGTACGTGGATGTGGTGTTTGCCAACC
GCCCGGACCCCAACACCCCGATGGAAG
gtaggtggtctgcggcggcgccaccggttaggcctgggcggggtctgaagggtctgaacc
tggggttgtagaggccgccagcatgggccctgctgggcacccgggtgagccgtgagagga
ggccgggtccagggtggggggcgagggggcaggcctcccctcagtagggggtgaactcag

 5.07 Intr +  69281  69366   86  0  2   94   64   124 0.761  10.64
tttcatcccaaaaaacccctcccacacccaacttcagagccaggaagtacactgcttgca
agacatcttcgcagcccctgtccctcctcccagcgtcctgcctgtatttgcagaatgtcc
cgaggctggccctgagccctggctgccccccacctgcggtttccctttctctcacgacag
AGACCGTCCGCGCCATGACCCACGTCATCAACCAGGGGATGGCCATGTACTGGGGCACGT
CACGCTGGAGCTCCATGGAGATCATG
gtacggtggccgcgcagcatgtgtgtgtccaggcacagactcccggcaccggctgcgtat
ggagaccccaaagctctggcggggtctgtgcctttggtcccaactgcaccgatgcctggg
tgctaagggagggacaggatggtggagtgtggtggttatgtctgtaggccttgcagacgg

 5.08 Intr +  70204  70324  121  0  1   96   52   223 0.995  20.07
agctcaccagggcctgcctggctcccagggaagctatgagtgtgagcagtggggagcccg
ggctgcagctgctgggccagcctgctccggggacaccttggtgccctctccatggctgcc
ccggcagcctcccgcctgctcacaggcaagggccctcggggtccctttctgccttcacag
GAGGCCTACTCCGTGGCCCGGCAGTTCAACCTGACCCCGCCCATCTGCGAGCAGGCTGAG
TACCACATGTTCCAGCGTGAGAAAGTGGAGGTGCAGCTGCCGGAGCTGTTCCACAAGATA
G
gtgggcaccctcgggcccctcgccccgccccaccccacccctgctctcgggcccagggct
tgactccacctgcttttcctcttcaggagtgggcgccatgacctggtcccctctggcctg
tggcattgtttctggcaagtacgacagtggcatcccaccctactcaagagcctccttgaa

 5.09 Intr +  70411  70505   95  2  2  131   67    92 0.729  11.58
aacctgaccccgcccatctgcgagcaggctgagtaccacatgttccagcgtgagaaagtg
gaggtgcagctgccggagctgttccacaagataggtgggcaccctcgggcccctcgcccc
gccccaccccacccctgctctcgggcccagggcttgactccacctgcttttcctcttcag
GAGTGGGCGCCATGACCTGGTCCCCTCTGGCCTGTGGCATTGTTTCTGGCAAGTACGACA
GTGGCATCCCACCCTACTCAAGAGCCTCCTTGAAG
gtgaaggaacagcctggtggggagggacgggcaggggataggcattttggacgggtggga
cctttgggccgactgctttggtgctgggcaggggttccgggagctgcagctgttcccacc
tcggtctgctgggggcgggctccttggcgtgagaacatggagcccctcctggcctgatcc

 5.10 Intr +  71517  71637  121  2  1   79   65   276 0.819  24.97
ctgcccactctcccctacttgagaggcctggggcaggggcactgccctggcttcaagatg
agaagagcccctatgagggagaagggtccagaaggaatgagcccatcggccccctgcacg
tgggggtccaggtgacctgctctcatctgtagctgtgctgctcccctcccccgcaaccag
GGCTACCAGTGGCTGAAGGACAAGATCCTCAGTGAGGAGGGCCGGCGCCAGCAAGCCAAG
CTGAAGGAGCTGCAGGCCATCGCCGAGCGCCTGGGCTGCACCCTGCCCCAGCTGGCCATA
G
gtaacggtggggtcgccatggggccagtgcccctggggagaacctgccccagctggccgt
aggtaacagggtggggttgccatggggccagtgtctccggggagagagggaagggatccc
tggacatcatcccccagccagcctcgggtaatcgggctctaaggggcatggttgggaccc

 5.11 Intr +  72150  72238   89  1  2   83  110   107 0.997  12.59
ccatgcctcctccagccacctcttagacaaagcccgtgcccagcactgcagggcttccta
gaccccctcagacccccagaccaagatgctgggtctctcggcccagtcagaggcaaggca
gacccatcaggggcccctgtggtgggtgtttctccctcaccttgggtctcgccgccacag
CCTGGTGCCTGAGGAATGAGGGAGTCAGCTCCGTGCTCCTGGGGGCCTCCAATGCGGACC
AGCTCATGGAGAACATTGGGGCAATACAG
gtaagagtgagaggccctgctgggcagagggcccatcccagcccgagccccgtccagtgc
atcctcccaggctcgtcctgcgtgccaggctctgttctaggcactcaggatgcgcccgtg
aaccatcagagttgtgctcctggagagcttgctttccagcaggaacagacatgaacacta

 5.12 Term +  73366  73455   90  0  0  102   46    77 0.836   2.92
cccaaaccttctgaaacacaaaagcagcgtggcctccatctgcctcagatggagcccaga
tgtgatggggcaacccgggcctggccagccgaccatctggaagagcctggccccacctcc
tccccaggccaggcccgtcttgttggtgggattctgatttgttgttgttcttgcacgcag
GTCCTTCCGAAACTGTCATCTTCCATTATCCACGAGATTGATAGTATTTTGGGCAATAAA
CCCTACAGCAAAAAGGACTACAGATCCTAA
gccgcccccgcccgcctgctcggacagtttccgttccctcctagtctctgttcgctcgct
taagctgttttgaagccaagtgaagagtgtggtttgcatccaagagaaaacaccacactg
tgatgtcatcgggaaatgatctcccaagtcgctgccagacaccacccactgcttcgccgg

Predicted peptide sequence(s):


>KCNAB2_1|GENSCAN_predicted_peptide_1|475_aa
MSLIHVVSVLHTPKQALTFNEPEELCEFQIRENEDSLPVKLELSFGTPIPSTSDSNGEKR
KRRKGEKRESPQLASTPAGAGQTLPFPVAVTDTGSGSGPSDYPERGSALTERPPQLSLMF
SAVYGADRNTQGCKRKVIADTVPCPDSSPVQLPGAAIELLKTVPPGSDEASCGVGEALGA
GTEGSLGPTAGEKLSPQPNSPKKGVLQTNEGAWKWILSYQRFPRPPPSQHAELTLSADAC
ACGSSPTGCALAAVLLSAMSPDCGAQGSLLLPGRHHALAACTRVCGAPVPSLGGLPPALM
LLLTAFPAPTSTPAGRLYAARRVLVMLKSSPHCCQQCAGIGCVPGSAVCRDRLCAGIGCV
PGSAVCRDRLCAGIGCVPGSAVCWGGLPTFYLRSLILSSLLPWEGVLLPPHATGDNTKGQ
RALDSGLADSKVCSELCTAEKPRAGSATPSPNFVPGHRGGSRLEGTGGPGEDGPE

>KCNAB2_1|GENSCAN_predicted_peptide_2|146_aa
MLSMTYSESLRSVSSRCHSEWALHPVRQTDTLELQRLREVRAAAQARNMESFLRMHGLSL
DGCTAQRTGMKYRSQALTTSSGSPGSTWLVARFIEQTVVAQLTIGHHFQLGRAGNPDKSP
GLSMTRFPYPESGDRGHYSRIVLRTK

>KCNAB2_1|GENSCAN_predicted_peptide_3|205_aa
MATARKRPREPRLGLLAAGRPSRSSGPRPLRLCSEQTKDTCMLRPGAQILAASPVPLGSG
AICPQETLLPRPGRDFIQKPRKLQAFLEESFLCPHPQPALAAQVLSPTVSKSVGQGWAHP
EGLALPSDPKCPPHTLQVDPGQSCLLGPLLSCQELCPQITENIRPHKNFNTNVHSSLIHN
SPKLETTQTPINRQMEKQDVALSRK

>KCNAB2_1|GENSCAN_predicted_peptide_4|71_aa
MAQGLFLWTLGCTTVGSRSTQTRLSDLVCFQRGIPCAISCGMSLELELPQYSSDQHFKSP
RPPGPIASSPL

>KCNAB2_1|GENSCAN_predicted_peptide_5|485_aa
MASHEDVPEFSVCTIPCTRKAHPDVAGLSWSLGGRISDLMLMLAHGPRFAWGSSLLMEHN
RVLTAAMEQSLMHSAFSSGSHSSILPMRQPPPQQCRSGPGVCAVGETLDKRPEWMSPTMH
QLWDVSCSIYKNNNSVLMCRCWERFNEMAEQLMTLAYDNGINLFDTAEVYAAGKRSSLVI
TTKIFWGGKAETERGLSRKHIIEGEDALGHLRAPIPVGSSSEAKVMAAQGPTPPVNPLRA
QSRGTRCSGLTFSFHPGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMA
MYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMT
WSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCT
LPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSK
KDYRS