GENSCAN 1.0	Date run: 14-Jan-104	Time: 16:39:53

Sequence CACNA1S_1 : 75452 bp : 51.67% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1428   1600  173  2  2   98    0   142 0.428   5.28
ggagcgaggagagtaatcctcctgcccccactcctgcccccgccccctggctggctcagc
agggcaggctcagccgacagcctcagccagcctagtccccaaggcgggggcattggggac
acagggaagggaaagcactggggtgggggagcaggagaaagccagattcccagggaagcc
ATGGAGCCATCCTCACCCCAGGATGAAGGCCTGAGGAAGAAACAGCCCAAGAAGCCAGTT
CCTGAGATTCTGCCAAGGCCACCCCGGGCCTTGTTCTGCCTGACCCTGGAGAACCCCCTG
AGGAAGGCCTGCATCAGCATTGTAGAATGGAAGTATCCTTCAGGGCCCGGGCC
gtgggggggggtgtgcgtcatgagggagggattcggggtgatcacagagcacaaacttcc
tacaggagggccagggaggcctggcacttagacatggggtgaactcacagaattgagtga
ggagctgggggaaggagccctcggctaagcaggagaggaggaggaggaagaggaggaaga

 1.02 Intr +   2846   2929   84  2  0  100   47    91 0.828   5.63
gggttctccctctcctccatcctctgctcctctgcgccctgcccctgtggccctcctctt
ttctcaaacactggaggttactgggaagagaatgggatttttctgtcaagcccaactacg
taatatgcctccccatccacccccaaacaactccctcgcttcctcccttgctttctctag
CTCTTTCCAGACTTGCTGCCTAATGGGCCAGAAAGTCGAGAAAGCCATGGGCCTGGGGTA
CCCTCTGGAAATGGCTGTGGCGGG
gtgggtgtgtctgggaggggtgaggtgtgatgggtgtgagcacgtgcacaccagcatgtg
cacatggctctggaaattcagcattcatctctccatctctccttcccagtcctactcagt
gagttctcaaccttaccctgcatcaacccttaccctcccatgccatttatctgggtaagc

 1.03 Intr +   3343   3450  108  1  0   64   95    68 0.968   5.00
gggcatggacaggcgctgagagtggagcggtgtgaagaccccctaggccttaaagctgag
gagccctcagccagggaccagacctttgccattccaaggagtctacatgaaagtgacttg
ttcctgaggagagggagccagaggtcaaggcaggaacctggtcctcactgtaccctgcag
GGGCTCAGGGAAGGAGCAGCGTGGGCGAGCGTCCATGAGCCTGTCCAGCAGCCTGGCATC
AGAGTCACAGTCCAGACTGACCCTCAGCGCCCTCATCCCCTTAACCCT
gtaagtcccttgcctcactcgagggctctccttaaccctggctccaggcccttcgagacg
atcatcttgctcaccatctttgccaattgtgtggccctggccgtgtacctgcccatgccg
gaagatgacaacaactctctgaacctcggcctggtaagattggcccttccatctcccttc

 1.04 Intr +   3498   3603  106  0  1   65   99   181 0.762  17.62
acctggtcctcactgtaccctgcaggggctcagggaaggagcagcgtgggcgagcgtcca
tgagcctgtccagcagcctggcatcagagtcacagtccagactgaccctcagcgccctca
tccccttaaccctgtaagtcccttgcctcactcgagggctctccttaaccctggctccag
GCCCTTCGAGACGATCATCTTGCTCACCATCTTTGCCAATTGTGTGGCCCTGGCCGTGTA
CCTGCCCATGCCGGAAGATGACAACAACTCTCTGAACCTCGGCCTG
gtaagattggcccttccatctcccttcctgcgagcctgcagccccaggcttggggaggcc
cccttggtggactctgttctgggggatggtgccggtggttcaactccctgacgatgcagg
ccctgcatccccagccacctgcagggctggctgagtggctcaatgggtttccagggtcaa

 1.05 Intr +   6924   7056  133  2  1   90   77    34 0.481   3.22
gggtcctgggccacttggcagaggcctgagtgggagaatgggaagggccgtgtctcaggg
aaggacatggctctggttgtctctaccctgggctgacattgctgcagtccattcagtaaa
tgacctatgaggttgagcctccaaggccctccccgattctgggtacttactgtttcccag
GAAGCAGAGATTGCAACACCCTTGGGTGCCGGATGTCCACTATGGGTTGAGGTGGTGGGT
CTGAGTGAAGGGGAGATGCCTGGCTCCACACCTCCACCTCTGGCCAGGGCACAGGATGTC
GGGCTGTGGGATG
gtgagggtggagggggaagattaggaggaggcgcttgtggcaatctgcacttgccctgca
caacactgaacagcaatcaaaagacaccacagtaggctgagaaaggggctgaaagaaagg
gaaaagctttatatttagtaccttcatcagcactcatttcctactgtttgaacgtggggg

 1.06 Intr +   8442   8572  131  1  2   56  103    25 0.230   1.72
tagaatctgcttttgagcccaggcccactcacctactagctgtgtgatcttagacaagtt
atgtaacctttctgttccctcagtttcctcctttataaaatggggatgatattgtatact
tgagagaggtaactggatgagtgaagaccttctaagttgtagtgctttatctatcaacag
AAGGAACTTTGATCATGCAGGCCCCACAGAGCAGGCTCACCAGCCAAAAAGCCTATAGTC
ACAGAGACCCCCAGGTTGTTCTAGATTCAAAGGGTCTAACCCCCAACAGTTATGCCAAAG
GATTATTTCAG
gtaaagaattcctcttcaccctgcccatcgtttgtccctgatttctctttaactctgtgt
cttctctccttgaaacccctaacttttcttaatggctttcctgatcacccctccccagtc
ctccagcaaatcagcagcagcagcagcaacaatgacattcaatatttatcgattacttgc

 1.07 Intr +  13117  13167   51  0  0   78   95    23 0.034   1.59
attaaatgtatgcatgtggccagaatagggccgggctcataagcgggtgcttactaaagc
ttagctattattatcctcattacccaagacagcactggtctccctttctctcccagcccc
cttcaccctgagcatgcagagccctactgggaccctcagccccattgtccctctgtctag
TCAGCCCTGGTGTGTCTGGCCCACCCAGACCTGAGGGAGCTTGGTTCCCTG
gtaagggaagtgctgtacagggaggggaagagggaactggaagagggaaatgagacccct
gagacagaggtaggatggcaagggatacccattccagttacgtctatttgggtgagcgtt
cgttgggctaaacatagccacttccctcactcctcagcaggtcatcttccaaacctggag

 1.08 Intr +  19746  19885  140  2  2   80   64   246 0.821  21.17
gtggcagtgtgggggcatgtaggtgtggagtgggggggtaggcattccatcagcaagtgc
aaacgtcctgaggtgggcgtgcctgagcaacagcagggaacccagcacggctgcagggaa
gagagcaagggtgcactcagagagcacagaggcatgctgtgaccacgtttgctcccacag
GAGAAGCTGGAGTATTTCTTCCTCATTGTCTTCTCGATTGAAGCCGCCATGAAGATCATT
GCCTACGGCTTCTTATTCCACCAGGACGCTTACCTGCGCAGTGGCTGGAATGTGCTGGAC
TTCACCATTGTCTTCCTGGG
gtgagagctgggtgtggggagactgaaggtcagaccctcgctgaggactgtgtgcccact
gccaccaccaccagcatcttagaggtggggtgggactccagcattgtgctaaccactgca
tggagcagcctctgttagaggccggcccagcaagggagctgtccatgttggtggagagtg

 1.09 Intr +  21653  21795  143  2  2  134   25   162 0.999  15.01
agtgaaattccccagataagcatgatcagatcatttgttagttgatgcacccgtatttgc
cgtctctcccctaggcctttccacaggtgctcaagcatggacaggacacagggcctcaga
ccactggggcagtggcttttccaacccctggaccccctctctccctcttctccattctag
GGTCTTCACCGTGATTCTGGAACAGGTTAACGTCATCCAAAGCCACACAGCCCCAATGAG
CAGCAAAGGAGCCGGCTTGGATGTCAAGGCCCTCAGAGCCTTCCGAGTGCTCAGACCCCT
CCGGCTGGTGTCGGGGGTGCCTA
gtgggtggcagtgtccctgcagacccctttctcctctcccttcctgttcccttgtccccc
agttctgggtccccttcctaccttgacatctcaggggcttcccaggatttatagggaggg
agggccaagagaccaagcagaggcgactcctcttttcccttccctgcctgcctctgcagg

 1.10 Intr +  21975  22127  153  1  0  128   99   301 0.996  35.76
agtgggtggcagtgtccctgcagacccctttctcctctcccttcctgttcccttgtcccc
cagttctgggtccccttcctaccttgacatctcaggggcttcccaggatttatagggagg
gagggccaagagaccaagcagaggcgactcctcttttcccttccctgcctgcctctgcag
GCCTGCAGGTGGTCCTGAACTCCATCTTCAAGGCCATGCTCCCCCTCTTTCACATCGCCC
TGCTGGTCCTCTTTATGGTCATCATCTATGCCATCATCGGGCTGGAGCTCTTCAAGGGCA
AGATGCACAAGACCTGCTACTTCATTGGTACAG
gtgagctcccagggaaagtggggctgtggggcagggcctaggatggctcagaagggggag
ccaccctacctggtgaaggagcccggagctcagccattgccgcccacatctgttgacctt
gagaatgggtttctcctggataagggggacttggaggaagggcagctctactggagtcag

 1.11 Intr +  24304  24509  206  2  2  112   55   290 0.998  27.54
agcccaaggcattcctcttcactgtcaccgtctgctccatgtgaagctgtcttttgcatt
ttcagcagagtgtctttagacttactgctcaattctcttaaattgctcttatacaccttt
cctcctgtcgttgtccacctactactgttgtctgatgttccctttgccttctgcctccag
ATATCGTGGCCACGGTGGAGAATGAAGAGCCATCGCCCTGCGCCAGGACGGGCTCAGGGC
GCCGGTGCACCATCAATGGCAGTGAGTGCCGGGGCGGCTGGCCAGGGCCCAACCATGGCA
TCACCCACTTCGACAACTTCGGCTTCTCCATGCTCACCGTGTACCAGTGCATTACCATGG
AGGGATGGACTGACGTCCTTTACTGG
gtgggtctgggcccgcgcctgcagaaccatctcccttcatccacaggcttgcaagggagt
ggggagggagggcttgccagtccacacaggaggccagtctctgacttgcgtgaccacagc
tccctcttgctcctccctggggaatctatacaggatgtgtgtccctttctggttcccagg

 1.12 Intr +  24689  24788  100  1  1   95   68    57 0.963   4.58
ggtgggtctgggcccgcgcctgcagaaccatctcccttcatccacaggcttgcaagggag
tggggagggagggcttgccagtccacacaggaggccagtctctgacttgcgtgaccacag
ctccctcttgctcctccctggggaatctatacaggatgtgtgtccctttctggttcccag
GTATGTGCCCCAGCATCCTATGGGGAAATCCCCATGATACAATATGTCTGTGCAGGATCC
AAGGGGCGGGTGAAGAATGGAAACCAGGAAAAACCTGGCT
gtgagtgactcaattctgatggcttagaatttcacactttttgaggaacgaagggccctt
tgagtctttttccttgcctctgcaagactgctttcccatataactattattagatattag
tttcctcacctataaaataaggataataatactgtctatatcagagttagtgggagaatt

 1.13 Intr +  25755  25941  187  1  1  105   86    63 0.904   7.07
ttggagggaaattaggtcagtcttgcccgggccaggtaggcagtcagcaaggtctcccta
gggagatccttccagaccagatcctagtcctcaggctggaaaagttcttccagactagtc
ctcaggttaggaaaaatgtcccctcaatatcccagcgtggcttctctccttgtcccccag
GGTTGGGTGGAGTCTTAATGAGCAGACTTGGGGAAGAGGAACCAAGCCCTCAACTCAGAG
GATCACACTTCTGTCCTGACCAGGTCAATGATGCCATCGGGAATGAGTGGCCCTGGATCT
ATTTTGTCACCCTCATTTTGCTGGGATCCTTCTTCATCCTCAACCTGGTGCTGGGTGTCC
TGAGTGG
gtaagaaattcaaaggtagccaggggagaaaagagaaagaggaggaggggagaaggagga
ggaaggaaaaggaacggagggaaaagaaacaggaggggtggggggcgagtggagaggagg
aggagagaagggaggaggaggaaggagtggagcagggcagggggctgtgagtcaggccct

 1.14 Intr +  28186  28331  146  1  2  109   42   267 0.780  24.64
aagtgagaggggctgtctctcagccaccttgaggggcacctggaccccaggcaacacccc
ggggccagaaaaaggagcgctccagtcacagaatgggcttgtctgtcctcaggaagctca
gtctttccttgacactgttccctcttctcctcctctcctggctcccccatctcatttcag
GGAATTCACCAAGGAGCGGGAGAAGGCCAAGTCCAGGGGAACCTTCCAGAAGCTCCGGGA
GAAGCAGCAACTAGATGAGGACCTTCGGGGCTACATGAGCTGGATCACGCAGGGCGAGGT
CATGGATGTTGAGGACTTCAGAGAAG
gtttgggcccaaaggctgtggtcagcactcaccccactctctcactcccacctctgagtc
ataccttgcaatcaggcccactgagcaagtccaacattagtcctttgagggtgagtgact
tgcctaaagcaaaatggctcaaaatggtaagatccaggtgtgaccagagctcttcccaaa

 1.15 Intr +  28736  28817   82  0  1  132   84    85 0.989  11.69
tgggctctttagctcttggaactctcagtctctggaaagcacgaagcaatccaggcctac
ctaggacccattgttgcagatgtctctggtcaatgggcccttgtctcgggtgcccagtcc
aggtgtgtccagcccagaggggccccgaaggctggctgactctttctctcctgtctccag
GAAAACTGTCTTTGGATGAAGGTGGCTCTGACACAGAGAGCCTGTATGAAATTGCAGGCT
TGAACAAAATCATCCAGTTCAT
gtgagtatctgcccactgccccaggaacccccaacccccagctccctgagacatgagggt
agagtccagttacttcccctcagtggtttcagagtcacttgtctaatcctttagaaaggc
agcctttttaagaaaatagggccagttcctgctctgagggactccgcagggaccagatcc

 1.16 Intr +  30445  30605  161  1  2   87  100   174 0.991  18.64
tgaaagatggaggattttactcagtctggctccctagctcatgccctgagcttctctcat
gtggctggcggaagtggggtggtcaggctacgcatgcctggagtttgtctgaaggtagct
tggacaggtggggcgtagaacagcacagcactgtagaccatcctctgtcccctccctcag
CCGACATTGGAGGCAGTGGAACCGCATCTTTCGCTGGAAGTGCCATGACATCGTGAAGTC
CAAGGTCTTCTATTGGCTGGTGATTCTCATCGTTGCCCTCAACACCCTGTCTATCGCCTC
AGAGCACCACAACCAGCCTCTCTGGCTGACCCGTTTGCAAG
gtgaggcggaacggagtgaagccgggaggagggcacatgtggctgtggcttgatgtcaaa
atcagccaatggcaccacaggttgtgcagaagaggtcaattagatattgacatcattttt
ctaaaaattatggaccatgagtgctggattatatgacctaatcagctcctttcacggggg

 1.17 Intr +  35663  35888  226  0  1   33   89   529 0.992  45.07
gtgccacttcactccagtctgggcagagtgaggccctgccccctgcacccccaaaaaaca
tccatggtgccttggaaacaagggaaggggcgtcctgggttgaggcccagccacagccaa
ggctgggagtcaggagaagggaaggagagtgatgccggggctgtgccaccaaccctacag
ACATTGCCAACCGGGTGCTGCTGTCCCTCTTCACCACTGAGATGCTGATGAAGATGTACG
GGCTGGGCCTGCGCCAGTACTTCATGTCTATCTTCAACCGCTTCGACTGCTTCGTGGTGT
GTAGCGGTATCCTGGAGATCCTGCTGGTGGAGTCGGGTGCCATGACACCCCTGGGCATCT
CCGTGCTCCGCTGCATCCGCCTCCTGAGGATCTTCAAGATCACCAA
gtgagtgccggggtcggctggcactcccgggtccccggcaggcaccacgggctggtctgg
tctacacccatctcatttcctgaggtctgggatctgtgcaggttcaccactggtcccttg
cccagacttccctccctccttgaaataacctccttctgtgaaaaaagaatcacttcccca

 1.18 Intr +  36640  36847  208  1  1  138   96   467 0.999  52.10
gtgctctgcaggaaggagagagtgggcatgcagccatgaatccagggtcttccagcagtg
aggcagccccctccctctgtgtcacatcagtcctgagtctttcccccaagcctgtccaca
cctcgtgggccccagtgagagggtctgtctcctcccaccttgtgcctcctcttccttcag
ATATTGGACGTCGCTGAGCAACCTGGTGGCATCCCTGCTCAACTCCATCCGCTCCATCGC
CTCCCTGCTGCTGCTGCTCTTCCTCTTCATCGTCATCTTCGCCCTCCTGGGCATGCAGCT
CTTTGGGGGGAGGTATGACTTTGAAGACACAGAAGTACGGCGCAGCAACTTTGACAACTT
TCCCCAAGCCCTCATCAGCGTCTTCCAG
gtaggctctccctctgcgtgtccctccttctgaacggttgctgaatcctgcttcttgtcc
ttcaagatcaaggtgggcatcaccttctccaggaagccttgtctgatctgctggttgagt
gcaatgtccttctctgggctcccctatcacctgtgcttctctccattgtaacacttgctt

 1.19 Intr +  38152  38291  140  0  2  102   23   140 0.669   8.67
ttccccagctggaataggggttttggggatagcaggggctggccacccagactgtggaat
gaaaagagggaaggtctgagagaaccacagagttggaggagaacttcggtcaatgcggtc
ccaatagaagactctcaggcccctctgtgttcccgagccctctatcctccctccatacag
GTACTGACAGGGGAAGACTGGACCTCAATGATGTACAATGGGATCATGGCCTACGGCGGG
CCGTCCTACCCTGGCATGCTTGTGTGCATTTACTTCATCATCCTTTTCGTCTGTGGCAAC
TGTATCCTCTCGGGAGCAGG
gtgcagaaaagagcttagggagggggtgggggaaagggcttaaaatgggggtcaagggtg
tccagtttctaggtagccaggccctctggctggaggggagctcccaggcccatgcggtag
ggggtaggacatagcaaatgcaggtacagctgtaggataattctttgtgccaaaaagatt

 1.20 Intr +  38891  38967   77  2  2   74   13     5 0.547  -8.75
gcagatatgagggtaaggtggatggggccggagagttactggcagtgcctgagccgtcct
ggtgcctgcaccttggaatgtgatactatggggagtggggaggaagggcaccgttgttcc
ccaactcatgtgtgcctcgcatgggtctcacttgttttgcctcactggctctccacgcag
CTCAGTGTGGGAGCTGGGACCAGTCTGGACAGGAAACGGATGGGATTCAAGGCCACAGGA
TTCAGGCTCCTTCCTGG
gtactctcagcaggcaggcttccctgagggccttccactatgtccctggatccacacctt
cccatgggtagctctgggagagtggggttaggtcctgcccacatgcaggcagacagaact
cctgccctgcaggctcccttccacctacaaccaaaggctccttagctaaacccgctcaga

 1.21 Intr +  39147  39261  115  1  1   -1   89   204 0.923  11.61
ggtactctcagcaggcaggcttccctgagggccttccactatgtccctggatccacacct
tcccatgggtagctctgggagagtggggttaggtcctgcccacatgcaggcagacagaac
tcctgccctgcaggctcccttccacctacaaccaaaggctccttagctaaacccgctcag
ACATCCTGCTCAATGTCTTCCTGGCCATTGCCGTGGACAACCTGGCCGAGGCGGAGAGCC
TGACTTCTGCCCAGAAGGCCAAGGCTGAGGAGAAAAAACGCAGGAAGATGTCCAA
gtgagtgcttccttagcaggaagggacctggagtgctcagtcgtggccatggccttccag
ctctggacagggcctccctgtaacccaatgatcagggtccctgacatggtgacacccacc
tcagtgggcaaacttctgtaacctgcacatgggggtggctgagatccttccctgggggca

 1.22 Intr +  40125  40218   94  0  1   59  105   138 0.999  13.07
ctctcaccacagagaagggacttgcctgagcccactgcccttcccatttgggggctgatg
ccactcctcctacagatcccctggagcccttggtgtgggatcctcctgaaggtgttgtca
ggttcagcagatccctgagaactttctggtttggcttccactttgggttttctaactcag
GGGTCTCCCAGACAAGTCAGAAGAGGAGAAGTCAACGATGGCCAAGAAGCTGGAGCAGAA
ACCCAAGGGTGAGGGCATCCCCACCACTGCCAAG
gtgagcacctcaggtggggatgttagaggcagtctaggggctcttccaatccatggttcc
cttcataccacagggtacaggtggggtagggtggggaggtaggagagttatcagccaggt
gagggcatctccctgcgtacgactggagggagagccagcgaatccatctccagggactcc

 1.23 Intr +  40943  41012   70  1  1   95   94   117 0.960  12.25
ctggccttgctgggcctggcctctcatttgtaaaatggggatgatcataatattccctgt
tccttaggctgtagggatgattaagtgagctgaacgctaacaggctctccagtatatgct
cattgaggggaaaccgcaacttctttttcattgttatagtcattgtgttccttcctacag
CTGAAAATCGATGAGTTTGAATCTAATGTCAATGAGGTGAAGGATCCCTACCCCTCAGCC
GACTTCCCAG
gtgaggatgctggagactggactggagcagggtgctggggtgaagtaggggtgtgccggt
cctgaattctccccatgggcagtctcttgtgtgtccctacctgtacccctccatgtggag
atcagaacaccggagacatcccttctgtgcaaataagccatctgccagcttgtctctctc

 1.24 Intr +  43363  43495  133  2  1  132   28   231 0.999  21.71
ctcactgtgaagagaaggagatgcccgggctggactctgccaaagccctagggtcccaag
tcagcctggtggtcccttgcttactggctgcaggggctcctaggagggctctgagcacag
aagccatgggcatagcaaagcatgggaagacacccctaattcctctctctctccccacag
GGGATGACGAGGAAGATGAGCCTGAGATCCCGCTGAGCCCCCGACCACGTCCCCTGGCTG
AGCTGCAGCTGAAAGAGAAGGCCGTGCCCATTCCAGAAGCCAGCTCCTTCTTCATCTTCA
GCCCCACCAATAA
gtgggtgccccttggctgctgtgggggtgattgatgcggctctcatctgcttccctgccc
tagaaaaaaccctgtctgactctccatgcctacagttatactatgagaaactcagtgttt
tagcttaagatcttgtgccctgtttaaaatgctagtatatctgggaaaagtaatgcttta

 1.25 Intr +  44166  44295  130  0  1   99   66   229 0.999  23.00
gagaggtcagggccccctgtgtgtccagccagaggaccctgcaggtgcagggctgcactt
ctctcctggccagggaggagcaggaggtgtattccatgttcgtccgcaggatggaggctg
atgaggcctgagcctccagcagctcacagctcccctgccctccctacctcgccccaccag
GATCCGTGTCCTGTGTCACCGCATCGTCAATGCCACCTGGTTTACCAACTTCATCCTGCT
CTTCATCCTGCTCAGCAGCGCTGCACTGGCTGCGGAAGACCCCATCCGGGCTGATTCCAT
GAGAAATCAG
gtgacgggcttcaccctctctgccactcagcacccctgccccctccagcctcagtctggt
gcccagggttcagctgtatcctctatgtggctacaagcatcagagtttcttagagttcag
ttcctcagggataggactgcccactccactccttctgaacggcacaggctggggcacaga

 1.26 Intr +  44463  44630  168  2  0   58  113   132 0.768  13.36
catgagaaatcaggtgacgggcttcaccctctctgccactcagcacccctgccccctcca
gcctcagtctggtgcccagggttcagctgtatcctctatgtggctacaagcatcagagtt
tcttagagttcagttcctcagggataggactgcccactccactccttctgaacggcacag
GCTGGGGCACAGAATGGCTCTGACTGCCTGCTTTATGCTGCTGCTGCTGCTGATACTGTT
GCCCCCTCCTCCTCTCACTGGCTGCTCCCGCCCCTGCCCTGTCCCCAGATCCTTAAACAC
TTTGACATCGGGTTCACCTCTGTCTTCACTGTGGAGATTGTCCTCAAG
gtgagtgaaggctgtggggcagccctggggagggagtttccctgatgtggctccagttta
cacacactgaactcaggggctggagagaagcagaaaagaggtggagactggcaggaaaga
ctcatgggacccagcacaccggcaggcccacaagtatctggatggagggctggaaagtaa

 1.27 Intr +  46774  46880  107  0  2  100   35   230 0.998  18.41
gcgagcagagataggaaatgcatttaggccactgcaaggagttgagtgaaatatagagat
ttctggaaggctattgcctcagtaagtgctctcctgagcagaggcgagaagcccttgtct
gtgggagacaggcctgttctccaagctcctccatccaggctgctgcctctttctccccag
ATGACGACCTACGGAGCCTTCCTGCACAAGGGTTCCTTCTGCCGCAATTACTTCAACATG
CTGGACCTGCTGGTGGTGGCCGTGTCCCTCATCTCCATGGGACTTGA
gtgagcagcggcaagggccagccctgggcacagaccaccctctgctctgtgccagggctt
tgtagtgggagtcccacccatgttggtgggcccctgccacaagaggagggtctctcgggg
cctccgatggaggcagggggtcctgtgggttgtcaccagctggaatgtgggttgccacca

 1.28 Intr +  47451  47538   88  0  1  125  100    99 0.999  15.27
tggctgtgccctggagtcgggcacactctcacggctggaggaaagggaaggggaaggtgg
gagtgttttcaggcagaaaggcagctggtgtggagggcaggatatggctggaggctccac
cgcagactgggctggctggagcaggctgccctcagccccctcaccattgccgccccccag
GTCCAGTGCCATCTCCGTGGTGAAGATCCTGAGGGTGCTGAGGGTGCTCCGACCACTCAG
AGCCATCAACAGAGCCAAGGGGTTGAAG
gtgagagagggcccgggcaggagccccagagaggaatgggaggggttacaggggcctcct
cgctccagaaacctcagcccagccatggctgggacccctgtcccatctccctgggcagat
aggggtaaggatgaggctggggtagctatgcttccccaccagcctttccccacctccaac

 1.29 Intr +  47822  47929  108  1  0   88  105   227 0.866  25.38
catctccctgggcagataggggtaaggatgaggctggggtagctatgcttccccaccagc
ctttccccacctccaactcatcaggaggcagcaagtcttgcactcctggggtttcctcaa
ctgggctagcagggttactgtgggtgcacccccagtccccattggcccctctgtccccag
CACGTGGTGCAGTGCATGTTCGTGGCCATCAGCACCATCGGGAACATCGTGCTGGTCACT
ACCCTCCTACAGTTCATGTTTGCCTGCATCGGCGTCCAGCTCTTCAAG
gtgagccccagcctgcgcgagcagctccccctcccgctcccagccctggtgcccactctc
aagcacaaggagccccacattgtgaaaacagatgtcttcgaatgcacagatttccatatg
agaatattttattttgaaaaataggtcttcaccacaccaaacacataagtttgcagaaag

 1.30 Intr +  51253  51305   53  0  2  107   88    36 0.850   3.69
ctctggggccctgccccaagggcgagttcacgcctctgagaggaagagatgggcttgggc
tccttttttcagatgcctgccttccctccccccttccactgttcactcccagagcccact
tttctatcctgtttccatgacaacatgcctccctccctccctccctcttcctggctgcag
GGGAAGTTCTTCAGGTGCACCGACTTGTCCAAGATGACAGAGGAGGAGTGCAG
gtacatggggcagggagcacagtgggacggtcacggggcagggagcatggtgggacagtc
acggggcagggagcactgtgggagggttacggtcacggggcagggagtgtggcaggacga
tcacagggcaggggactgtgtgttggtggatgacggcccttcaagctggaaactggggaa

 1.31 Intr +  51677  51823  147  2  0   66   70   304 0.976  26.26
aggcttaggagggacactcacagaggcccctttcctcggactcgcccagcggtgtcccct
tgggtcccagatctggaacttcatttctccttcacactccccacccagggcccagaggat
gtgggtggggcaaggcagcccagccatgccctgtggagtgactgggcctccctgccacag
GGGCTACTACTACGTGTACAAGGACGGGGACCCCATGCAGATAGAGCTGCGTCACCGCGA
GTGGGTACACAGCGACTTCCACTTCGACAATGTGCTCTCAGCCATGATGTCCCTCTTCAC
GGTCTCCACCTTCGAGGGATGGCCTCA
gtgagtgatggctggggcctaggtccctcatggacatggtcaggtaggaccaggcagcca
gcctgcccttctgcagcccccacggtgctactgctacctgtggcaggcgtccaacaaacc
caccaactctctgatggtttgatggtatgttgactggtcactccaaagtaggcctgacca

 1.32 Intr +  52299  52500  202  0  1   93   51   546 0.999  51.21
gccattccaggattgggtctggtctttcctggcgccgacctaactcctgtcccgtaactt
gattgttgagaaggctctcttggctctccacagccagtgggataaagcccatccttccca
gcctgactctctgccttgtcaccccacccagtctgtcctctcttctctgcccacccccag
GCTGCTGTACAAGGCCATAGACTCCAATGCGGAGGACGTGGGTCCCATCTACAACAACCG
TGTGGAGATGGCCATCTTCTTCATCATCTACATCATCCTCATTGCCTTCTTCATGATGAA
CATCTTTGTGGGCTTCGTCATTGTCACCTTCCAGGAGCAGGGAGAGACTGAGTACAAGAA
CTGTGAGCTGGACAAGAACCAG
gtgcctgggctgcctgccagaggtggagggcagagctccagcaggcctcctgctggccca
agccctaggttcagccagggaagagaggcctaagggtgaccccagaacctgcatttgatg
ccaagccctagcctccatgcaccctaccctatctccaaactgaagcaatacaagttggta

 1.33 Intr +  52951  53109  159  0  0  100  110   219 0.999  26.00
tgtgataactcaaggggaacccaaagcccaacaggattattcccctaaacagttcacagt
cctcagccacagcccctggccacagctgctcctgacttgcccgtcaatcccatggatgtg
ggtgtggagagggagggaggggcctcttggtgctgacctgtcctgttgtatgtgtcacag
CGCCAATGTGTACAGTATGCCCTGAAGGCCCGCCCACTGAGGTGCTACATTCCCAAAAAC
CCATACCAGTACCAGGTGTGGTACATTGTCACCTCCTCCTACTTTGAATACCTGATGTTT
GCCCTCATCATGCTCAACACCATCTGCCTCGGCATGCAG
gtaagggctccccaggagaaaaatgtctgatcagactgggacctgggccttgggtagggc
aggatgagtagggcaggatagccaggattccccccagtagacatttcttgtgcactgtgt
gctgaggtgctacatggaatacagaagtgaactgcgcacaggccttgtcaccaggcactt

 1.34 Intr +  54468  54578  111  2  0  140   96   260 0.751  33.08
ttggcggaactcaggggattgctaaagcagcttctagttttctgagctaaaacaaagtga
gcagggggcccaagaaagggttgggggcttcccaggaagaggcaggggctctgggaatgc
aatctacagggtgggcaaacccggcccccctgacccactgctcctgtgtcccctccacag
CACTACAACCAGTCGGAGCAGATGAACCACATCTCAGACATCCTCAATGTGGCCTTCACT
ATCATCTTCACCCTGGAGATGATCCTCAAGCTCATGGCCTTCAAGGCCAGG
gtgagtgtgggggccaccgggccagatgagaagctggggctggtgggtgggaccttccag
tggaacatccacccccatccctcatcctatcagggctcctttgcccagcacttctgctcc
caacttgctcacccctttgcccacttccaccttcagacacagggcaggcagatcttcatg

 1.35 Intr +  55276  55359   84  0  0  122   86   139 0.977  17.61
ggagtgttggagttgggggagcccactggagcaccagtgggaggtggagtcatgggcacc
ccaccttggcctaacccgcagctccgcattagctcgggtgggacactgtcctctgccagc
agccagagctccttcctcccaaagctcaccccctcgctttcccatccttttccttcccag
GGCTACTTTGGAGACCCCTGGAATGTGTTTGACTTCCTGATTGTCATTGGCAGCATCATT
GATGTCATCCTCAGTGAGATCGAC
gtgagtatcaggcaggcagagccatcactagggtgggcccaagagcatgtgttcaatcca
cagatatttgtggggtgcccactgtgtgtacaacatggaaccccaggggttaaaaagatg
gaatgacaagtcacggcttctgccctcaaggaactatcatcctgctgggcagagaggtaa

 1.36 Intr +  60180  60308  129  2  0  123   56   214 0.885  23.10
agagccctgtgcccaaggatggtcccgaactagtggacagcaggggccagaggcggggct
ggagttcctccatgccacaaacatctccccaaaacacacagtgcacctccctccccgccc
tgccccttacccctctgaggttctgcccccagactgacctctggggctgctgccccgcag
GACCCAGATGAGAGTGCCCGCATCTCCAGCGCCTTCTTCCGCCTGTTCCGTGTCATGAGG
CTGATCAAGCTGCTGAGCCGGGCAGAAGGAGTGCGAACCCTCCTGTGGACGTTCATCAAG
TCCTTCCAG
gtgcaacagggaccctggaaactgcacgtacctggggaggccactagggacatctgcctc
agcccagggtgggccccaggggagccctgggcaaggcagagccctggggagctaacagag
ggcagggctgcagacacacagtggagccctaagacactgactggcgctcccgcccgccct

 1.37 Intr +  60493  60765  273  0  0  100   34   298 0.769  23.87
aacagggaccctggaaactgcacgtacctggggaggccactagggacatctgcctcagcc
cagggtgggccccaggggagccctgggcaaggcagagccctggggagctaacagagggca
gggctgcagacacacagtggagccctaagacactgactggcgctcccgcccgccctgcag
GCCCTACCCTACGTGGCTCTGCTCATCGTCATGCTCTTCTTCATCTACGCTGTCATCGGC
ATGCAGGTGAGAGGCAGGCGGGCCCAGGCCAAAGCATGGATCTTGGCCAAGTTAGAGGGG
GCATCAGTGGACCCTGAGGAGCCTGAGCAGCACACGGGCTGGACCCTCCGCCCTCCCTGC
CTTGCTCGTGAGAAAGAAGGAGGGACAACCTCCCTGATCGTGGATGGCTGGAGTGTCAGA
TGCTTGGATGCCAGCCAGGAGAAACCTGGGCAT
gtgggtggacagcaggggccaggctgtctctctaaggcctgactggagccctgggtggcc
tctgtctaccctcccctgagagcacttcccccacacattgacttaccgggtctgcttgct
gctgggaaaacgggtctaccctccctcttttctttggcttgctaagaagaactttacctg

 1.38 Intr +  61119  61216   98  2  2   53  -63   133 0.569  -5.99
ttacctgatctagaaaataatcccgttttttttggcttcaggtctgatgtggcccgcaat
gaagggaattttggggaagtaggggcgaaggtaggggtcaggcaggagaaggcagtgggg
gataagctgaggggacactttaatctaggttccacagtcagggccctttgtgacttgcag
ATGTTTGGGAAGATCGCCTTGGTGGATGGGACCCAAATAAACCGGAACAACAACTTCCAG
ACCTTCCCACAAGCTGTGCTACTGCTCTTCAGGCACGC
gtctcccgccacccccacccctaccccgctgaccagtccagcctttgctctgttctaatg
tgcactggagccagggctggcttcatgggtgtgtgacctgtgcagccacacagggtccta
tactcagaagggtcccctgcttggttgcatgctctgccgtcactgccttgaagatattca

 1.39 Intr +  62624  62783  160  2  1   86   85   227 0.972  22.70
ggggaaactgaggcccagctcacactgagctacacagtgaacatgaagatctgacctcct
taccattggacaacagccccagtttgctcatctgtccacaccctgctgccacctgactgc
cagccttctgaggggccaggcaggagcagataggtgacaggagcctcttctgtcctctag
GTGTGCAACAGGTGAGGCCTGGCAGGAGATCCTACTGGCCTGCAGCTATGGGAAGCTGTG
TGACCCAGAGTCGGACTATGCCCCAGGGGAGGAGTACACATGTGGCACCAACTTTGCATA
CTACTACTTCATCAGCTTCTACATGCTCTGTGCCTTCCTG
gtgagatgctgagggcctgcggggcagggagagggctttgataagctgaggcatggggga
gcctgcctgccccttcctggccagtttccacctctcctgggattcatctcggggacgcag
gaggctctagttaggttgtcccccattctggtcatcctgagtgtggctttgtttcctggg

 1.40 Intr +  63251  63378  128  1  2  128   78   212 0.998  24.18
caagagcacagagacatgacagagcattgctgtgtgtgtgatgtgggtggttcagaaggg
ctagaatcaagggcacaggaagcgagaagttgtgggccagtggacacctcccagctcccc
caccctaaccctgtaccacctgcctttctgtgttgggaccccttggttcttctcttgcag
GTCATCAACCTCTTTGTGGCTGTCATCATGGACAATTTTGACTACCTCACCCGGGACTGG
TCCATCCTGGGCCCTCATCACCTGGATGAGTTCAAGGCCATCTGGGCAGAGTATGACCCA
GAGGCTAA
gtgagtccaatctgtaggctctgtgctgggccctccatcctagacccttcctaccgtctc
acagggagtcactctccagtttattcagtatgagtgggcttctccttcccccttcattta
tctgaggtctcagatcagagaatcagagtatctccaggttggagggaatcctacagcttt

 1.41 Intr +  64668  64764   97  0  1   80   86    71 0.543   6.61
atcctaacattgtctcttcttttaaaagggagctgggctcccacttcctaaacacagttg
gaaaataaggaaatgctcccctgtttcctggctttctttcccattgcccatcctctgagc
agaaaggttctggcagcggaggagggtagcaggtacacaagtctgtgtgtcctcccgcag
GGGGAGAATCAAACACCTGGACGTGGTGACCCTGCTGAGAAGGATTCAGCCCCCTCTGGG
CTTTGGGAAGTTCTGCCCACATCGGGTAGCTTGTAAG
gtaaccagagctgccagggatgggtggccccagggaggggaagagtcactgaggcagagg
gaaactggtgaggacctgatggagtgaagcattgtagagccgggatctcctgggtcccca
agttcctcccaaagggcctgaagtctcagcaatgtcacccaactcatcattctgtcccct

 1.42 Intr +  65083  65185  103  0  1   68  100   222 0.258  21.65
tgaagtctcagcaatgtcacccaactcatcattctgtcccctcacaaaggatgtcctggt
cagctgacacccccagccctcgtgtcccgtcccctcccggtccacagaccgggtgaggat
gacttgccaagcttggcctggtcccagctcagcggcaggccactgcgtctccctgtacag
CGGCTGGTGGGCATGAACATGCCCCTGAACAGCGACGGCACAGTCACCTTCAATGCCACA
CTCTTTGCCCTGGTCCGCACGGCACTCAAGATCAAGACGGAAG
gtgagagtgccttccaatgtgagccccctcctttctcccagaggctgtttctggcacaga
ttctgccagattctcagagctcaagattgctcttaagaactgtgggaagaagtagaggga
ggaccccaggccatgggcacaaagtcctcatgcccctcagggctcagagggagcctgagg

 1.43 Intr +  65415  65588  174  1  0   45   44    93 0.581   1.03
tctggcacagattctgccagattctcagagctcaagattgctcttaagaactgtgggaag
aagtagagggaggaccccaggccatgggcacaaagtcctcatgcccctcagggctcagag
ggagcctgagggttttctgcagggcaaagatcatcaagggtctgttcccacactcctcag
CTGTGTCTGGGGGCCAGAGAAGGGCCAGTGCTGGCACAGGGGTCAGGGGTGCCCTGCAGT
TTGGCTGTGAGCAGGAGCAGAGGAGGTTCTCAGGCAGCACTGGGCAGGCTGACGGGAGTC
CACATTCGACTCCACTAAATCTGCAGGTCCTCACCTACTGGGAAGACAAGCATG
gtgggagcaggggaaggagtcagggtggggtctcagtattgtctctgagcccttgctcag
ggctcacactgtatcaagctcaagtctccagctgtatcaggtccatccccacatggggac
cactccaggagtctgagacaacctcagggtgagcttcattagcagggcaagatgaggaag

 1.44 Intr +  66141  66242  102  1  0  110   92   194 0.999  22.65
ccccagggggacagtgatgccctcccaccattgccagtacccagcaaggcagctgccaca
aaactcagccaatgtttcttagtaaatgactggctgtctgaaaggttcagaaagaactgg
gtggccttgtcaagtgcagttggtgtgatctgggtaacttttgcctttctcctgctccag
GTAACTTTGAGCAGGCCAACGAGGAGCTGAGGGCCATCATCAAGAAGATCTGGAAGAGAA
CCAGCATGAAGCTCTTGGACCAGGTCATCCCTCCAATAGGAG
gtaggtgctactttgggggaccagagtccagaagcagccaaggaatgggagtggggagct
tctccaaggagccccatgggaatctgagaacggaccagatcctccataaatgccttaggt
agatcccacgggcatccaacctcaggatggaaagtgcccagtgaccaagtcagcaagaca

 1.45 Intr +  66528  66652  125  1  2   79  115   250 0.860  27.61
ataaatgccttaggtagatcccacgggcatccaacctcaggatggaaagtgcccagtgac
caagtcagcaagacaaaggattgcttgcatgcccgggcctggctacagctggctcccact
ctgaatccagtgtcagattcccactagccttcagggcatctcttgttggctcctctgcag
ATGATGAGGTGACAGTGGGGAAGTTCTACGCCACATTCCTCATCCAGGAGCACTTCCGGA
AGTTCATGAAACGCCAAGAGGAGTATTATGGCTATCGGCCCAAGAAGGACATTGTACAGA
TCCAG
gtaagcccaatccaggtatgttccaaggggctcccccactgagccaggtctccagactct
agttatccttccatgtccttgaggggccaatgatggagacatagagggaaaaaggaagcc
cagaagagtgaaaaaatgtcaagacagttctgggtagtccatgattgaagatgtttcaac

 1.46 Intr +  69311  69439  129  1  0   89   76   158 0.998  16.10
caggaggctgaggcaggagaatcacttgaacccgggaagcagaggttacagtgagctcag
attgtgccactgcactccagcctgggcaacagagtgagactctgtctcaaaaaaagaaaa
agtggttctggtctcctctcctgggctggagagataactgagtcccttcgtcatccccag
GCAGGGCTGCGGACCATTGAGGAAGAGGCAGCCCCCGAGATCTGTCGCACGGTCTCAGGA
GACCTGGCTGCTGAGGAGGAGCTGGAGAGAGCCATGGTGGAGGCTGCGATGGAGGAGGGA
ATATTCCGG
gtgagggagagccaggagcacccctagtggtctagacaccatgagtggcagtgtctcaca
gagaggagggctgggagcccagccacacgagagggggacatgggagctgaagatacccca
ctccgtctctccacttcaccacccacctctcctgggactcagaatcaatgacctgatcta

 1.47 Intr +  70236  70486  251  2  2  116   72   292 0.818  27.17
aactttctaagggtgggaattttcttcttttgatctcaccactcagtccatcctcctttg
gccttataagatttgtctcccaatactattgcttgttcccaataccactgtcccagagtg
acagccccccatgccctccctgccctcacccccagtcactgctcttctccttgcccctag
AGGACTGGAGGCCTGTTTGGCCAGGTGGACAACTTCCTGGAAAGGACCAACTCCCTGCCC
CCCGTCATGGCCAATCAGAGACCCCTCCAGTTTGCTGAGATAGAGATGGAAGAGATGGAG
TCACCTGTCTTCTTGGAGGACTTCCCACAAGATCCACGCACCAACCCCCTGGCTCGTGCC
AATACCAACAATGCCAACGCCAATGTCGCCTATGGCAACAGCAACCATAGCAACAGCCAT
GTGTTTTCCAG
gtagtggcggccactgccatccctgggtgtagaggtactgggaggacaatgtcagcaggt
tccaggttggattggaagagggtaccccaaatttgtagggtgtcttttgcttgcctttgt
gccccaatccatcctgaaccttaatgtaagaggccgacctcgatggcagaggcttctttg

 1.48 Intr +  73054  73145   92  1  2  106   92    36 0.322   5.94
tgcctggcctggagttgattgggcctcatcatgtgtccaccctctaagacaccttctgca
gccctgagaatctcagagctctcacagagtgtggctagccagccaagcgagcctctgttg
actcagggctcctggcaggagtcagcagcccctcttatccttgccccttcttgcatacag
GACCCCACAGCAAACCCTGTGTGGAGATGCTGAAGGGACTGCTGACCCAGAGGGCAATGC
CCAGAGGCCAGGCACCTCCTGCCCCCTGCCAG
gtaacagtggcagaggcctgggagcaaactccatacagagaccctgcctggcctgatact
tggagtgggatcatggcaggggaaggctgtggcagcaatgtgtccaacagtacagaaggg
acgggatccctccatcctcccctttctgtggatcttggttgagttgccctcagatgatct

 1.49 Intr +  73319  73536  218  0  2   20  105    24 0.300  -3.95
ctgccaggtaacagtggcagaggcctgggagcaaactccatacagagaccctgcctggcc
tgatacttggagtgggatcatggcaggggaaggctgtggcagcaatgtgtccaacagtac
agaagggacgggatccctccatcctcccctttctgtggatcttggttgagttgccctcag
ATGATCTGGAATTTTGCTCATTGGTGGGCTCCAGCACCCCTGTCGGGGTCTTTGCTTTTG
TACCTTTGGAACAGTGCCCCAGGGTGGAGTCCTCCATGCCTGAGGACAGAAAGAGCTCCA
CACCAGGGTCTCTTCATGAGGAGACACCCCACAGCAGGAGCACCAGGGAGAATACTTCCA
GGTGCTCAGCACCAGCTACAGCCCTGCTGATCCAAAAG
gtgagccaggggctgggtcacagcagtggctgcattgagtggtggccctgtgatggcctg
gcgtggagagagggtagggccaacagaggcaggtccccaaatgtggctccccaggaagac
cccactcagcctactctcctccctgcaggctctggttcgagggggcctgggcaccttggc

 1.50 Term +  73685  73936  252  1  0  114   44   233 0.988  17.47
cagcaccagctacagccctgctgatccaaaaggtgagccaggggctgggtcacagcagtg
gctgcattgagtggtggccctgtgatggcctggcgtggagagagggtagggccaacagag
gcaggtccccaaatgtggctccccaggaagaccccactcagcctactctcctccctgcag
GCTCTGGTTCGAGGGGGCCTGGGCACCTTGGCAGCTGATGCAAACTTCATCATGGCAACA
GGCCAGGCCCTGGCAGATGCCTGCCAAATGGAACCAGAGGAAGTGGAGATCATGGCAACA
GAGCTACTGAAAGGACGAGAGGCCCCAGAGGGCATGGCCAGCTCCCTGGGATGCCTGAAC
CTCGGGTCCTCCCTGGGCAGCCTCGACCAACACCAGGGCTCCCAGGAGACCCTTATTCCT
CCAAGGCTGTGA
tgcccacacagcatcagcatgggcttagagctggcatgaccaatgggggtggggaagttg
ctggggtggagaagggctagcccaccgcagcagcctccctccctctcagcagctagatgc
atggcctgaggcagggtggtcaggaaccacctcaaaaagtgcggaggaagtagctggaca

Predicted peptide sequence(s):


>CACNA1S_1|GENSCAN_predicted_peptide_1|2284_aa
MEPSSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLENPLRKACISIVEWKYPSGPGPSF
QTCCLMGQKVEKAMGLGYPLEMAVAGGSGKEQRGRASMSLSSSLASESQSRLTLSALIPL
TLPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEAEIATPLGAGCPLWVEVVGLSE
GEMPGSTPPPLARAQDVGLWDEGTLIMQAPQSRLTSQKAYSHRDPQVVLDSKGLTPNSYA
KGLFQSALVCLAHPDLRELGSLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNV
LDFTIVFLGVFTVILEQVNVIQSHTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQV
VLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEEPSP
CARTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVCAP
ASYGEIPMIQYVCAGSKGRVKNGNQEKPGWLGGVLMSRLGEEEPSPQLRGSHFCPDQVND
AIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDL
RGYMSWITQGEVMDVEDFREGKLSLDEGGSDTESLYEIAGLNKIIQFIRHWRQWNRIFRW
KCHDIVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTTEMLMKM
YGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFKITKYWT
SLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQA
LISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNCILSGAGSVWELGP
VWTGNGWDSRPQDSGSFLDILLNVFLAIAVDNLAEAESLTSAQKAKAEEKKRRKMSKGLP
DKSEEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPE
IPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILL
SSAALAAEDPIRADSMRNQAGAQNGSDCLLYAAAAADTVAPSSSHWLLPPLPCPQILKHF
DIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISVVKI
LRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFF
RCTDLSKMTEEECRGYYYVYKDGDPMQIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEG
WPQLLYKAIDSNAEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETE
YKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICL
GMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSII
DVILSEIDDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLI
VMLFFIYAVIGMQVRGRRAQAKAWILAKLEGASVDPEEPEQHTGWTLRPPCLAREKEGGT
TSLIVDGWSVRCLDASQEKPGHMFGKIALVDGTQINRNNNFQTFPQAVLLLFRHACATGE
AWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFVAVIMDN
FDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRV
ACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEAVSGGQRRASAGTGVRGALQFGC
EQEQRRFSGSTGQADGSPHSTPLNLQVLTYWEDKHGNFEQANEELRAIIKKIWKRTSMKL
LDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLRTIEEE
AAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPPVMANQ
RPLQFAEIEMEEMESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSRTP
QQTLCGDAEGTADPEGNAQRPGTSCPLPDDLEFCSLVGSSTPVGVFAFVPLEQCPRVESS
MPEDRKSSTPGSLHEETPHSRSTRENTSRCSAPATALLIQKALVRGGLGTLAADANFIMA
TGQALADACQMEPEEVEIMATELLKGREAPEGMASSLGCLNLGSSLGSLDQHQGSQETLI
PPRL