GENSCAN 1.0	Date run: 14-Jan-104	Time: 19:38:55

Sequence ANGPTL3_1 : 9755 bp : 29.81% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1257   1711  455  1  2   89  106   261 0.887  20.05
acggcttaatgattaactatgttcacctaccaaccttaccttttctgggcaaatattggt
atatatagagttaagaagtctaggtctgcttccagaagaaaacagttccacgttgcttga
aattgaaaatcaagataaaaatgttcacaattaagctccttctttttattgttcctctag
TTATTTCCTCCAGAATTGATCAAGACAATTCATCATTTGATTCTCTATCTCCAGAGCCAA
AATCAAGATTTGCTATGTTAGACGATGTAAAAATTTTAGCCAATGGCCTCCTTCAGTTGG
GACATGGTCTTAAAGACTTTGTCCATAAGACGAAGGGCCAAATTAATGACATATTTCAAA
AACTCAACATATTTGATCAGTCTTTTTATGATCTATCGCTGCAAACCAGTGAAATCAAAG
AAGAAGAAAAGGAACTGAGAAGAACTACATATAAACTACAAGTCAAAAATGAAGAGGTAA
AGAATATGTCACTTGAACTCAACTCAAAACTTGAAAGCCTCCTAGAAGAAAAAATTCTAC
TTCAACAAAAAGTGAAATATTTAGAAGAGCAACTAACTAACTTAATTCAAAATCAACCTG
AAACTCCAGAACACCCAGAAGTAACTTCACTTAAA
gtaagtagaaaataaagagggttcatgtttatgttttcaatgtggatcttttaaaaaaaa
tatttctaaggcatgccatttgaaatactttgttgcattgttgaaatacttttttttcca
agaaaaataatctccagaaaataaaatttcctattataatttcaagttagttttttgttt

 1.02 Intr +   2346   2456  111  2  0   56  111    83 0.600   7.06
taaaatgttaaggacaaaaatatgtgctatttgaaagaagcatacaaggggaaggaattg
ccaatattcatttttcaaatccattattagtttaaaaatttagattatgatagtgttaca
ggaaattaatagaaaagaaagaggaaagcaacttataaccaacctactctctatatccag
ACTTTTGTAGAAAAACAAGATAATAGCATCAAAGACCTTCTCCAGACCGTGGAAGACCAA
TATAAACAATTAAACCAACAGCATAGTCAAATAAAAGAAATAGAAAATCAG
gtaagtcagtattttaatggtatgtcccatctttcacacaggtctgtaaaaacactgaat
cctaaaattatttacaagctttaactggatcatgagtaaaattatcacatcagcataact
gttaaaattgcaggctctgaagctaataaactacctgcatttaaaccatggctctaaaac

 1.03 Intr +   4732   4846  115  0  1   38   95    30 0.297  -2.20
ttaaatattttgagaacaggtaatctgtacaatctgaataacactgtttatctaaatatc
aaacaccgttataacattatgaactgaaagacaaactgtacttctgacatccttactcag
atttcccctaattgtatattcagtatcattttaaaaaacagatttatattcttttatcag
CTCAGAAGGACTAGTATTCAAGAACCCACAGAAATTTCTCTATCTTCCAAGCCAAGAGCA
CCAAGAACTACTCCCTTTCTTCAGTTGAATGAAATAAGAAATGTAAAACATGATG
gtaagacactttggtgggtttccttcttgaagctattattatcaaattccctattcttag
gacttgttctagactaaaagatagttaagagatatccatcaaatacaatgtatcaaccta
aactggatgctggggttctttttacaccctataaaagacatacctaagacaatcagagaa

 1.04 Intr +   5419   5532  114  2  0   49   98    43 0.340   0.90
tggtaagatgattcttacattcttaaataacacgccatctaagaaaaatgctttaacata
aacattactgaaaaaatgctacatttgccacaacttcataaaatgtcaagtgaaatctca
agctccaaagatattattcctattactaaatctgatgtaataacattttattgattctag
GCATTCCTGCTGAATGTACCACCATTTATAACAGAGGTGAACATACAAGTGGCATGTATG
CCATCAGACCCAGCAACTCTCAAGTTTTTCATGTCTACTGTGATGTTATATCAG
gtaaaacctgtctaaggagaatagacagtagttagttcaacttactcattacgtattagg
aagattaacctggttatcattgttttatacatatatatatgaaatatatatgagtattcg
tataaatataatacttttaccttgtttatgtatttactcaatattctccttttcctctaa

 1.05 Intr +   7619   7885  267  0  0   86   70    92 0.294   3.78
gcacatagctatcttcaataaaattgttttaaaaggtattattttaagatacactaaaat
gatcaagggattcaagactaaacaactcaattagttgcaccaataaaaaacacttaaaaa
aactgtcagtgtccaacctgtacttaataactcacagatttttaaaacttttcttttcag
GAGAATTTTGGTTGGGCCTAGAGAAGATATACTCCATAGTGAAGCAATCTAATTATGTTT
TACGAATTGAGTTGGAAGACTGGAAAGACAACAAACATTATATTGAATATTCTTTTTACT
TGGGAAATCACGAAACCAACTATACGCTACATCTAGTTGCGATTACTGGCAATGTCCCCA
ATGCAATCCCGGAAAACAAAGATTTGGTGTTTTCTACTTGGGATCACAAAGCAAAAGGAC
ACTTCAACTGTCCAGAGGGTTATTCAG
gtatctttttctgataccaatactttattttcatatcttcaaagtatcttcccacattat
tagctattatctgcaatgacaacttttaaaaatccgaatcccaaataagcgttttctctc
tagacgaaaacctcttaactataatgaaagtgttcattctagttcaatcaggtattttac

Predicted peptide sequence(s):


>ANGPTL3_1|GENSCAN_predicted_peptide_1|355_aa
XISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQ
KLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKIL
LQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQH
SQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRG
EHTSGMYAIRPSNSQVFHVYCDVISGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYI
EYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSX