GENSCAN 1.0	Date run: 14-Jan-104	Time: 15:22:56

Sequence ANGPTL1_1 : 22465 bp : 33.90% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   6462   7284  823  2  1   68  113   641 0.925  59.51
tttaagaaattaataaagttaattctagcctaatctattaacaccaataaatattcagtt
tttccctcagatagtttttaagattactgactttaacatagattaatatgaattcttttt
gctttttctccttcactgatttgtttttcaaaagacatcattttacaacctcatttcaaa
ATGAAGACTTTTACCTGGACCCTAGGTGTGCTATTCTTCCTACTAGTGGACACTGGACAT
TGCAGAGGTGGACAATTCAAAATTAAAAAAATAAACCAGAGAAGATACCCTCGTGCCACA
GATGGTAAAGAGGAAGCAAAGAAATGTGCATACACATTCCTGGTACCTGAACAAAGAATA
ACAGGGCCAATCTGTGTCAACACCAAGGGGCAAGATGCAAGTACCATTAAAGACATGATC
ACCAGGATGGACCTTGAAAACCTGAAGGATGTGCTCTCCAGGCAGAAGCGGGAGATAGAT
GTTCTGCAACTGGTGGTGGATGTAGATGGAAACATTGTGAATGAGGTAAAGCTGCTGAGA
AAGGAAAGCCGTAACATGAACTCTCGTGTTACTCAACTCTATATGCAATTATTACATGAG
ATTATCCGTAAGAGGGATAATTCACTTGAACTTTCCCAACTGGAAAACAAAATCCTCAAT
GTCACCACAGAAATGTTGAAGATGGCAACAAGATACAGGGAACTAGAGGTGAAATACGCT
TCCTTGACTGATCTTGTCAATAACCAATCTGTGATGATCACTTTGTTGGAAGAACAGTGC
TTGAGGATATTTTCCCGACAAGACACCCATGTGTCTCCCCCACTTGTCCAGGTGGTGCCA
CAACATATTCCTAACAGCCAACAGTATACTCCTGGTCTGCTGGGAGGTAACGAGATTCAG
AGGGATCCAGGTTATCCCAGAGATTTAATGCCACCACCTGATCTGGCAACTTCTCCCACC
AAAAGCCCTTTCAAGATACCACCGGTAACTTTCATCAATGAAG
gtgagttacctcttactgtaaaaagtgggagtatgaggtttatatttttatgccttatga
aacaatgctcataataaatgcttattcattttgcgatgttatatatgtacattaaaattt
ctattgttttttattaatatcaagaattgaacttaaatacatctcctcttccagctctga

 1.02 Intr +  18451  18644  194  2  2   34   94   127 0.942   6.19
ttaatgttccagatagaactggagtcacccttttatttagttatattttataatattgta
tatatgataaacaatggtaactgtaaacaaagacacaaaggtaaaaatcttgattaaaaa
cttttaacatgtctcttctcatattaagtttgctgataataaatgatatttaaattatag
GACCATTCAAAGACTGTCAGCAAGCAAAAGAAGCTGGGCATTCGGTCAGTGGGATTTATA
TGATTAAACCTGAAAACAGCAATGGACCAATGCAGTTATGGTGTGAAAACAGTTTGGACC
CTGGGGGTTGGACTGTTATTCAGAAAAGAACAGACGGCTCTGTCAACTTCTTCAGAAATT
GGGAAAATTATAAG
gtaaatcagtgatgcagacctaagggaagtaaaacaaatccattcttgcaataatgcaag
aaacaagatgctatgcaataaataagacacacagttaaaaataactatccatatgttttt
tcattatctacatctgtcaaaaaaatgattctcatctctggttttaaagtcaaaattaaa

 1.03 Intr +  19285  19555  271  0  1   73  111   237 0.947  20.69
aacaaaaagagaatgacaatgtgtggcttataaaacgcaagtgaccaactaaaatggaag
ctcacattaccacttaaatggccagtatctttatgctatcgaatgtttaacactgctctg
taaaaatgtttactatctctatacttatttatgcactcatgtttcttcacttattaacag
AAAGGGTTTGGAAACATTGACGGAGAATACTGGCTTGGACTGGAAAATATCTATATGCTT
AGCAATCAAGATAATTACAAGTTATTGATTGAATTAGAAGACTGGAGTGATAAAAAAGTC
TATGCAGAATACAGCAGCTTTCGTCTGGAACCTGAAAGTGAATTCTATAGACTGCGCCTG
GGAACTTACCAGGGAAATGCAGGGGATTCTATGATGTGGCATAATGGTAAACAATTCACC
ACACTGGACAGAGATAAAGATATGTATGCAG
gtaagtatgaaaaactttcattctttgtagaatcatcaccttctatgcattaaatagaat
ctactaatatatatgctactaaagtcttttcaaaaaggtcagttttggtcactgtggcag
gaaatacaaccaacctactgaaagaaatagcttttaggatttcttctataaggcaatccc

Predicted peptide sequence(s):


>ANGPTL1_1|GENSCAN_predicted_peptide_1|430_aa
MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRI
TGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLR
KESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYA
SLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQ
RDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPEN
SNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLS
NQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTT
LDRDKDMYAX