GENSCAN 1.0	Date run: 14-Jan-104	Time: 18:14:15

Sequence AGT_1 : 13982 bp : 53.00% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   4499   5327  829  1  1   67  116  1011 0.997  94.80
aatccatttcttcttttttttgtagacatgaatggatttattctgggctaaatggtgaca
gggaatattgagacaatgaaagatctggttagatggcacttaaaggtcagttaataacca
cctttcaccctttgcaaaatgatatttcagggtatgcggaagcgagcaccccagtctgag
ATGGCTCCTGCCGGTGTGAGCCTGAGGGCCACCATCCTCTGCCTCCTGGCCTGGGCTGGC
CTGGCTGCAGGTGACCGGGTGTACATACACCCCTTCCACCTCGTCATCCACAATGAGAGT
ACCTGTGAGCAGCTGGCAAAGGCCAATGCCGGGAAGCCCAAAGACCCCACCTTCATACCT
GCTCCAATTCAGGCCAAGACATCCCCTGTGGATGAAAAGGCCCTACAGGACCAGCTGGTG
CTAGTCGCTGCAAAACTTGACACCGAAGACAAGTTGAGGGCCGCAATGGTCGGGATGCTG
GCCAACTTCTTGGGCTTCCGTATATATGGCATGCACAGTGAGCTATGGGGCGTGGTCCAT
GGGGCCACCGTCCTCTCCCCAACGGCTGTCTTTGGCACCCTGGCCTCTCTCTATCTGGGA
GCCTTGGACCACACAGCTGACAGGCTACAGGCAATCCTGGGTGTTCCTTGGAAGGACAAG
AACTGCACCTCCCGGCTGGATGCGCACAAGGTCCTGTCTGCCCTGCAGGCTGTACAGGGC
CTGCTAGTGGCCCAGGGCAGGGCTGATAGCCAGGCCCAGCTGCTGCTGTCCACGGTGGTG
GGCGTGTTCACAGCCCCAGGCCTGCACCTGAAGCAGCCGTTTGTGCAGGGCCTGGCTCTC
TATACCCCTGTGGTCCTCCCACGCTCTCTGGACTTCACAGAACTGGATGTTGCTGCTGAG
AAGATTGACAGGTTCATGCAGGCTGTGACAGGATGGAAGACTGGCTGCTCCCTGATGGGA
GCCAGTGTGGACAGCACCCTGGCTTTCAACACCTACGTCCACTTCCAAG
gtaaggcaaacctctctgctggctctggccctaggacttagtatccaatgtgtagctgag
atcagccagtcaggccttggagatgggcagggggcagccctgcggacatacctggtgacc
acccttgagaagtggggaagtggctgctccgctgggtccctggatgggccgtccacctcc

 1.02 Intr +   9122   9389  268  0  1   97   74   333 0.926  29.93
aatatttgagccacacttgcggtcctgtggccaggagaatgcagagtggcctgggggggg
ccaaggaaggaggctgaggcagggcgaggggcaggatctgggcctttggtgtctgccagc
cctcattcctgcccctgtcttgggtgactcttccctccctgtctcctgtctggatttcag
GGAAGATGAAGGGCTTCTCCCTGCTGGCCGAGCCCCAGGAGTTCTGGGTGGACAACAGCA
CCTCAGTGTCTGTTCCCATGCTCTCTGGCATGGGCACCTTCCAGCACTGGAGTGACATCC
AGGACAACTTCTCGGTGACTCAAGTGCCCTTCACTGAGAGCGCCTGCCTGCTGCTGATCC
AGCCTCACTATGCCTCTGACCTGGACAAGGTGGAGGGTCTCACTTTCCAGCAAAACTCCC
TCAACTGGATGAAGAAACTATCTCCCCG
gtaggagcctcccggtctcccctggaatgtgggagccacactgtcctgcccaggctgggg
gcggggtggggagtagacacacctgagctgagccttgggtgcagagcagggcagggccgc
ggtggcacggggctgggcaggcggcctgtgtgtctgtctaccagtcctctatccagccag

 1.03 Intr +  10985  11129  145  2  1   93   87   175 0.776  18.69
atttttattgtaggttttgctgaaattttccccaagggggaggatgacttagttgggtga
tggggggagcaaacatccctgtcgtcagggttgggtgcaaggagcataagcctgcctggc
ctctgggagagccctcactgtgtggcctggagccttcctaactgtgcatcatctccccag
GACCATCCACCTGACCATGCCCCAACTGGTGCTGCAAGGATCTTATGACCTGCAGGACCT
GCTCGCCCAGGCTGAGCTGCCCGCCATTCTGCACACCGAGCTGAACCTGCAAAAATTGAG
CAATGACCGCATCAGGGTGGGGGAG
gtatgtgtgagcctgtgtctgtgcctgacctgggttccaagtgtgcacagggtgggaggc
atggatgtaagggacacagaggaggctatgggtggggccagcagggcaagagggagcgga
gagtagggccaaaggtgggagagaagtagccagagcattctggggccttccaggtgcaga

 1.04 Term +  11993  12181  189  1  0  119   54   138 0.955  11.27
acccttgcctacactgaggggcaggcatacactgtgcatcctcctggcaggctggaaaat
gtccccctccaggacagtgcacagcacagaggtcctgagcccaccccggccctctagccc
tcagcaccctgggtcacccagtgcgccctcagaatgatcctgatgtctgctgctttgcag
GTGCTGAACAGCATTTTTTTTGAGCTTGAAGCGGATGAGAGAGAGCCCACAGAGTCTACC
CAACAGCTTAACAAGCCTGAGGTCTTGGAGGTGACCCTGAACCGCCCATTCCTGTTTGCT
GTGTATGATCAAAGCGCCACTGCCCTGCACTTCCTGGGCCGCGTGGCCAACCCGCTGAGC
ACAGCATGA
ggccagggccccagaacacagtgcctggcaaggcctctgcccctggcctttgaggcaaag
gccagcagcagataacaaccccggacaaatcagcgatgtgtcacccccagtctcccacct
tttcttctaatgagtcgactttgagctggaaagcagccgtttctccttggtctaagtgtg

Predicted peptide sequence(s):


>AGT_1|GENSCAN_predicted_peptide_1|476_aa
MAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIP
APIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVH
GATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQG
LLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAE
KIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVS
VPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWM
KKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIF
FELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA