GENSCAN 1.0	Date run: 14-Jan-104	Time: 20:52:35

Sequence ADAMTS4_1 : 11680 bp : 53.73% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1752   2239  488  1  2  103  102   354 0.890  31.62
cggcctcagtccctcccagctgcagtaccagtgccatgtcccagacaggctcgcatcccg
ggaggggcttggcagggcgctggctgtggggagcccaaccctgcctcctgctccccattg
tgccgctctcctggctggtgtggctgcttctgctactgctggcctctctcctgccctcag
CCCGGCTGGCCAGCCCCCTCCCCCGGGAGGAGGAGATCGTGTTTCCAGAGAAGCTCAACG
GCAGCGTCCTGCCTGGCTCGGGCGCCCCTGCCAGGCTGTTGTGCCGCTTGCAGGCCTTTG
GGGAGACGCTGCTACTAGAGCTGGAGCAGGACTCCGGTGTGCAGGTCGAGGGGCTGACAG
TGCAGTACCTGGGCCAGGCGCCTGAGCTGCTGGGTGGAGCAGAGCCTGGCACCTACCTGA
CTGGCACCATCAATGGAGATCCGGAGTCGGTGGCATCTCTGCACTGGGATGGGGGAGCCC
TGTTAGGCGTGTTACAATATCGGGGGGCTGAACTCCACCTCCAGCCCCTGGAGGGAGGCA
CCCCTAACTCTGCTGGGGGACCTGGGGCTCACATCCTACGCCGGAAGAGTCCTGCCAGCG
GTCAAGGTCCCATGTGCAACGTCAAGGCTCCTCTTGGAAGCCCCAGCCCCAGACCCCGAA
GAGCCAAG
gtaggcatctctggagtctgtgtcctgcggtgtcctcccgccatgtctgtcctactgacc
cctattcaccctctctccacccacttacacttctggccgttctgcttccctcccttctgc
ctgcctttcctttctccatgagcctcctttcttggtaaggctcaggcctctccccttcac

 1.02 Intr +   3133   3276  144  0  0   87   53    51 0.839   2.49
cctccaaccacacagggcagacacgttgcagcccagccctctagccctggtcccataggc
cccagccacactcaggcctggagaaccccaaagtccctcctgacggcagtccaggctgct
ttcacctctggggctcccgcagccctgggatgtggcgtccccttctcctccccttcttag
AACCAGCTGCTGACTCCTCAGAGTTACCACAAAAGCCCTGAGATTTGGCGTTGGGGGAAG
GGCCCAACCAAGACCCGCCAGGAGTCAGGAATCCCGTGGGGTGTGTGGGGCCCAGCTGAC
TATGCTGAGTTCCAGACCCAGGAA
gtgagggattggagaatcgaccgacccatgggtctgagaggctatttcaggatcttcctc
tccctttttctctacagcgctttgcttcactgagtagatttgtggagacactggtggtgg
cagatgacaagatggccgcattccacggtgcggggctaaagcgctacctgctaacagtga

 1.03 Intr +   3354   3677  324  2  0  110   94   396 0.998  38.92
gatttggcgttgggggaagggcccaaccaagacccgccaggagtcaggaatcccgtgggg
tgtgtggggcccagctgactatgctgagttccagacccaggaagtgagggattggagaat
cgaccgacccatgggtctgagaggctatttcaggatcttcctctccctttttctctacag
CGCTTTGCTTCACTGAGTAGATTTGTGGAGACACTGGTGGTGGCAGATGACAAGATGGCC
GCATTCCACGGTGCGGGGCTAAAGCGCTACCTGCTAACAGTGATGGCAGCAGCAGCCAAG
GCCTTCAAGCACCCAAGCATCCGCAATCCTGTCAGCTTGGTGGTGACTCGGCTAGTGATC
CTGGGGTCAGGCGAGGAGGGGCCCCAAGTGGGGCCCAGTGCTGCCCAGACCCTGCGCAGC
TTCTGTGCCTGGCAGCGGGGCCTCAACACCCCTGAGGACTCGGACCCTGACCACTTTGAC
ACAGCCATTCTGTTTACCCGTCAG
gtgaggccccagtcagcaccgcaggccatgcactgcacaattctaagaagcgccactaca
tagactatgatgcaaatgatgttcctggagttgtgtgacatggtgccttgccccagccac
actgccatgtgtggctacctaggccctgacagtgctgggtcctcagtgcccaggtccccg

 1.04 Intr +   3931   4087  157  0  1  109   62   168 0.525  16.40
aaatgatgttcctggagttgtgtgacatggtgccttgccccagccacactgccatgtgtg
gctacctaggccctgacagtgctgggtcctcagtgcccaggtccccgggaatctggatct
caacccaatggacccaggtgtcttggctgtctatgcaccttctatgatccctctccacag
GACCTGTGTGGAGTCTCCACTTGCGACACGCTGGGTATGGCTGATGTGGGCACCGTCTGT
GACCCGGCTCGGAGCTGTGCCATTGTGGAGGATGATGGGCTCCAGTCAGCCTTCACTGCT
GCTCATGAACTGGGTAAAGTAGGGGTGGATGAGAAAG
gtattagggaggagaaggtgggggagggggtagcaagttcaccacagtgttaatgggggt
cccaaggtattcttcccccaggcctaggtatagggctattactcctctctgctccaggtg
tagacatacatttacatttttctattaaataaattagttggtcgaaactactgtgaactc

 1.05 Intr +   4599   4769  171  1  0   91  103   174 0.998  19.63
cagagaaagagacggggctacatactgggagccctgagagtaccataaaggaaaggactg
ggggcagggtgaggtgggtaatggatctgatcatccacagctgcagccagatttattatg
gagtccctcagggcatggggaagggaccctcagatcctatcagggcctttgctcccacag
GTCATGTCTTCAACATGCTCCATGACAACTCCAAGCCATGCATCAGTTTGAATGGGCCTT
TGAGCACCTCTCGCCATGTCATGGCCCCTGTGATGGCTCATGTGGATCCTGAGGAGCCCT
GGTCCCCCTGCAGTGCCCGCTTCATCACTGACTTCCTGGACAATGGCTATG
gtaagcagatggcacttacctttccctgggtagcactcaattcctgtcctccagggcact
ctcacttccgctgcattctgcatggaccaaattgcctcccccaagtgtgcttcctctgca
gtgtgggaaggggtgagaaatgctgctgtctttgtgtagttctcacttcctcccagaata

 1.06 Intr +   6013   6299  287  2  2  101   45   243 0.945  18.90
aaaaaaaaaaagtaagtaattaaaataaaaattataaataacaaaaatttaaatcctctt
atagtcctaggattgtttttctaggctccatcaggccccagggagcctaagctttctgct
ggcaatcctgaatgctcccctcagcccgttgctgactttgtgccccaacccccttcccag
GGCACTGTCTCTTAGACAAACCAGAGGCTCCATTGCATCTGCCTGTGACTTTCCCTGGCA
AGGACTATGATGCTGACCGCCAGTGCCAGCTGACCTTCGGGCCCGACTCACGCCATTGTC
CACAGCTGCCGCCGCCCTGTGCTGCCCTCTGGTGCTCTGGCCACCTCAATGGCCATGCCA
TGTGCCAGACCAAACACTCGCCCTGGGCCGATGGCACACCCTGCGGGCCCGCACAGGCCT
GCATGGGTGGTCGCTGCCTCCACATGGACCAGCTCCAGGACTTCAAT
gtgagatcctagggcaggggtggggtaaagggcccgggggtgtggggactggccttaagc
ccaggagagagttcacttatgccccacttccgttctgtgcctttgcagattccacaggct
ggtggctggggtccttggggaccatggggtgactgctctcggacctgtgggggtggtgtc

 1.07 Intr +   6408   6594  187  2  1  106   94   108 0.990  12.98
acaccctgcgggcccgcacaggcctgcatgggtggtcgctgcctccacatggaccagctc
caggacttcaatgtgagatcctagggcaggggtggggtaaagggcccgggggtgtgggga
ctggccttaagcccaggagagagttcacttatgccccacttccgttctgtgcctttgcag
ATTCCACAGGCTGGTGGCTGGGGTCCTTGGGGACCATGGGGTGACTGCTCTCGGACCTGT
GGGGGTGGTGTCCAGTTCTCCTCCCGAGACTGCACGAGGCCTGTCCCCCGGAATGGTGGC
AAGTACTGTGAGGGCCGCCGTACCCGCTTCCGCTCCTGCAACACTGAGGACTGCCCAACT
GGCTCAG
gtgaggagtaggggggatgggagcccttgggaggggacagtagagcaggaaggactgtcc
cttgagtgcaagaccaagggggtgttgattcccctgctgctgtggggagtgcctttaacc
tctgggaattgtccttggccgtctgcagggaagagcagagctgtgctgtctagagttctc

 1.08 Intr +   6846   7021  176  1  2   55   76   264 0.944  22.08
gaccaagggggtgttgattcccctgctgctgtggggagtgcctttaacctctgggaattg
tccttggccgtctgcagggaagagcagagctgtgctgtctagagttctcaggggttgggt
ggagggatgtggggtgatgtgaggaaggaaggaggggctctgactgttttacccctccag
CCCTGACCTTCCGCGAGGAGCAGTGTGCTGCCTACAACCACCGCACCGACCTCTTCAAGA
GCTTCCCAGGGCCCATGGACTGGGTTCCTCGCTACACAGGCGTGGCCCCCCAGGACCAGT
GCAAACTCACCTGCCAGGCCCAGGCACTGGGCTACTACTATGTGCTGGAGCCACGG
gtgagggtcaggacacccccaggccctgtctatggtcacacacacccgcagtgctccctc
tgctttctgataacaaagatcacccaaagtaaccctgttcctacagccacgccagcccag
tccaggattccactcagacttatctgtacatgggtatcaggaaaacgagccccagactcc

 1.09 Intr +   7994   8169  176  1  2  117   19   193 0.855  14.55
taattattattgttatgattatcacccacatggtggccggcactcacccatctacatccc
ctacttcatccaacttttccgacaacattgcttccctgatgggacatgggtctcgtttga
tttaccaaccccttttgacttaggaggaaccttcagcattgttctttctcttttcctcag
GTGGTAGATGGGACCCCCTGTTCCCCGGACAGCTCCTCGGTCTGTGTCCAGGGCCGATGC
ATCCATGCTGGCTGTGATCGCATCATTGGCTCCAAGAAGAAGTTTGACAAGTGCATGGTG
TGCGGAGGGGACGGTTCTGGTTGCAGCAAGCAGTCAGGCTCCTTCAGGAAATTCAG
gttctttcaccatcattcctccctctaccttcctggacattctgggtcctagtgatgcag
aggggaactcagcactgtttccactctcaaagagctcacagtctagcgggagatagacga
gtaggcagctacagtgcggtttcccatgtattcatccgaagttggaacagggtgttgtga

 1.10 Term +   8670   9096  427  0  1  107   37   417 0.998  33.65
ccagagataagaggcagtagggcacatgtgcatgtagctctgatccagaccgaacagctc
acataggattgggtgacagccatctacacacatgtacacacatacagtcacataagcaca
gctcagaaggctgaggggattcaggtgatcctgagctccccatctactccttccacacag
GTACGGATACAACAATGTGGTCACTATCCCCGCGGGGGCCACCCACATTCTTGTCCGGCA
GCAGGGAAACCCTGGCCACCGGAGCATCTACTTGGCCCTGAAGCTGCCAGATGGCTCCTA
TGCCCTCAATGGTGAATACACGCTGATGCCCTCCCCCACAGATGTGGTACTGCCTGGGGC
AGTCAGCTTGCGCTACAGCGGGGCCACTGCAGCCTCAGAGACACTGTCAGGCCATGGGCC
ACTGGCCCAGCCTTTGACACTGCAAGTCCTAGTGGCTGGCAACCCCCAGGACACACGCCT
CCGATACAGCTTCTTCGTGCCCCGGCCGACCCCTTCAACGCCACGCCCCACTCCCCAGGA
CTGGCTGCACCGAAGAGCACAGATTCTGGAGATCCTTCGGCGGCGCCCCTGGGCGGGCAG
GAAATAA
cctcactatcccggctgccctttctgggcaccggggcctcggacttagctgggagaaaga
gagagcttctgttgctgcctcatgctaagactcagtggggaggggctgtgggcgtgagac
ctgcccctcctctctgccctaatgcgcaggctggccctgccctggtttcctgccctggga

Predicted peptide sequence(s):


>ADAMTS4_1|GENSCAN_predicted_peptide_1|845_aa
XRLASPLPREEEIVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLT
VQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGG
TPNSAGGPGAHILRRKSPASGQGPMCNVKAPLGSPSPRPRRAKNQLLTPQSYHKSPEIWR
WGKGPTKTRQESGIPWGVWGPADYAEFQTQERFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGKVGVDEKGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFI
TDFLDNGYGHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWC
SGHLNGHAMCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDC
SRTCGGGVQFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNH
RTDLFKSFPGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVC
VQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHI
LVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLS
GHGPLAQPLTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRP
WAGRK