GENSCAN 1.0	Date run: 14-Jan-104	Time: 17:03:18

Sequence ACTN2_1 : 79832 bp : 43.26% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1367   1492  126  1  0   91   82   282 0.672  28.06
cagccggagctggtgcttcgcccgagacccagcgcccaggcgtgtcgccccgagaggagc
cgcgcgaaggtcaccccgcgcccgccgcccgccgcccgccgcctccgtgggtccgtttgc
cagtcagcccgtgcgtccgagcccctcgcgccccgccgcagccccggccaaccgagcgcc
ATGAACCAGATAGAGCCCGGCGTGCAGTACAACTACGTGTACGACGAGGATGAGTACATG
ATCCAGGAGGAGGAGTGGGACCGCGACCTGCTCCTGGACCCAGCCTGGGAGAAGCAGCAG
AGGAAG
gtcagcaggggcccgcgggccgcccgcgcgtggtggggccgggtcccccgcggggctccc
gtgcgcgtggccgcgtggcctggcgactggcgagagggcgctttgtggaggtgctgtgct
gtcctgtgccctcgcagccccgggggccccttaggaaagaggacacgtccggggacaggc

 1.02 Intr +  32551  32665  115  0  1  117   77   139 0.923  15.72
ctaaaatcgttcttttgggtttccagttcttctttccatcaaattctgcatcctctagaa
gcccaagcagccccagccttgtagattcccaagaacgtgtaaggtgtcaagtgtcgtctg
tgaggaagggatctgaaatccgatggacctgtgctaaaccgtgtttggttttctttgcag
ACCTTCACTGCCTGGTGTAACTCCCACCTAAGGAAAGCCGGCACCCAGATTGAGAACATC
GAGGAAGACTTCAGGAATGGCCTTAAGCTCATGCTGCTTTTGGAAGTCATCTCAG
gttggtgttatatatcccatcctatgctttcatgtgttatcagtaggtgagcatctattt
aaagatgactacatcagaagttcgctttgaacttggctgggcaagaacatggtattattg
ccaaagaaaacctttccaaagaacaatctgcctggagttatttttccgttctaaaaaaag

 1.03 Intr +  33587  33706  120  0  0   81  100   104 0.953  11.37
tgaaagtttctgggttagtgttccctcattgctgtgatttagagagaccaggcacacatc
agaaatagtcatgtaaccttctctttttaaggaaaagatggatgcttagttttggcatct
tgattccgcatcaagaggtcactgtctctatgtctgcatgattctcttttcatccaacag
GGGAAAGGCTGCCCAAACCTGACCGGGGAAAAATGCGGTTCCACAAAATTGCTAATGTCA
ACAAAGCTTTGGATTACATAGCCAGCAAAGGGGTGAAACTGGTGTCCATTGGCGCTGAAG

gtgagaggtgtggtgggtggtcctgtctgccacactgacctaatagcgtaggtgtgggct
gcgacttgaattctccccttcttccctccctttcaccatttactgtacctgccttgtatc
aggctctctcttagggcgctcggtgcacaaagataagaacaaatggtaccatgagtggga

 1.04 Intr +  34798  34884   87  2  0   87   93   108 0.977  11.14
tttggttatgaatactgtatttataaccagacatactgcggtgcttataaaaacataaac
tggtctttccatccatatgcacattttccaatagctctgaagtcaacatttatatatagg
aaaaaagttacgtacagactatgttatctttacattaatttgttgttttcttacctgcag
AAATTGTTGATGGCAACGTGAAAATGACCCTGGGTATGATCTGGACCATCATCCTTCGCT
TTGCTATTCAGGATATTTCGGTTGAAG
gtaaaagacatggttaaaagtctaattgtataatctgtaaattgagcttgtgaattaaaa
tttgagcaagatgttttaaagtccaacagtcacttacatgattgaatgagagacatgtaa
gtgggttcttataaattttgtatgtgtataggaaaagacctcggcagcactgtttcattc

 1.05 Intr +  40626  40713   88  1  1   83   71    69 0.973   3.73
aagtgtcatcagaatttactcaccaagatcagggttctggctcctatgcacttgccgagg
ctgtaggaagagaccccctgggtgatcgaccccctgggaggtctgtttcaaaagtgacta
ggagctaagtgaactaagcggcatttccctggggccactttttcttggctgtcattacag
AAACATCTGCCAAAGAAGGTCTGCTGCTTTGGTGTCAGAGGAAAACTGCTCCTTATAGAA
ATGTGAACATTCAGAACTTCCATACTAG
gtgagcacccagggcccctggtccttgtattctcagtggaatctgtgggtagcatgggga
acagtgtttgtgtgcacccgtgttttcctcctgtctgagaagccttttatgtatcgagga
gaactcaggctgtagaattcttgatgcttaaagtctcccagaggaaaacattggattaag

 1.06 Intr +  41628  41784  157  0  1   77   -1   112 0.263   1.21
gtgtcaggcactgagccaggccttgggaagacaaaggggaagagaatccttctttgtccc
tacaccatgctgtttggcagatgagaggagctaccaagggctgggactttctgcaggtgt
caaagtcagagtgcccagatctgcatccactcatcttgcttttctttttctggctcctag
TTGGCCCAAGTACTTCAGCATTGTAGCACTGATAACTCTCACGGAGGTCTCCTTCCCCAG
ACCCTTTGAGGAACAGAACTCCCACACTCTGCTGTCACTGAACCCGCTGTCGCCAGCAAG
CTCTGGCCTGCCCTTGTCTATGGGGCATTTAGAGCTG
gtgtctacggcggaacagaccagaaataaacatctgccctgctaattgcatgtcctcctt
cacctacatgcctttgccttaaaaaaagaaaaagaaaaaaaaaagaacttaaagacagag
gagtatctgggacctaatggaggtttttgaagcgtcctaaaaacttttagaggaagtgtg

 1.07 Intr +  45926  46007   82  1  1   75  100    95 0.489   8.61
ttttgatgtttctctaaatgtttgaagtgattgggaaaagatgaaaaggaaagttacact
attatgattgtgtgtgggtgggaaggtgtccggcctaaagtgaggtacataagaaacatt
cttcataagtcttgtttcaaaatatattttaaaaatctgactgtcttggttttcatacag
GATGACCCCATAGGAAATATTAACCTGGCCATGGAAATCGCTGAGAAGCACCTGGATATT
CCTAAAATGTTGGATGCTGAAG
gtgagatgaaaattgtgtttgctgagttacaggaaatttgaagactacaaatgttatggc
tacacattgggaccttgcaaaattttatagcgaagttacatccgaagtactttggattcc
taacaaatttctgtcactggccacataagtagtagagattttcatgtgtagcttgttcat

 1.08 Intr +  50328  50413   86  1  2  104   78   112 0.990  11.34
aatcatttcgatacaatatggccttcctgaggttcgggaccacgggcccatgaaacacag
aaatctggtcagtgtaaaccaatttgttcttccctctgttctccctggtttctctccttc
gtctgtatgtgtgtggtgtgtgtgtgtgcgcgcgtcctgtgttattttctcccccttcag
ACATCGTGAACACCCCTAAACCCGATGAAAGAGCCATCATGACGTACGTCTCTTGCTTCT
ACCACGCTTTTGCGGGCGCGGAGCAG
gtactcaacacttgtccgtccgggctgttgtgttactctctgttggttttagttgtgtgt
gcatacttgagtgtgtgtttgtgcgcttcacatcttaccttggaatctttctgagtgttt
tctaataacctcatatggcaagttctaaactgtgaaaacttttttttaacagctttaact

 1.09 Intr +  51815  51907   93  1  0   92   88    50 0.936   5.56
tgtgaaatgattcatagtacgcataagccatgccttcagtctgaccgcaccctaagctag
actctgcaccgtctacagcacgccaccctcctcgtcccctctcatcacccacctcgttcc
atgctgtgtgtgcgcattcccgtcgacagagccgtcctgtttacctattgtgttttacag
GCCGAGACAGCGGCTAACAGGATATGTAAGGTTCTTGCTGTGAATCAAGAGAATGAGAGG
CTGATGGAAGAATATGAGAGGCTAGCGAGTGAG
gtaaaggaaactggtgacctgcagttctgtccatcctcacgcaggggctgaggcacagag
ggtgaaaaaatactccgtgggggcatatatatatatatatatattttgcatttttcatct
cagataggatgaaagtaggaaaatacacttgatctctgaggttgttcctattgtagtaac

 1.10 Intr +  53995  54225  231  0  0   10  109   464 0.929  38.67
ctcgcggccatgggcggacactgaacatctcgttcatgcctctgtgcgtagaggtaccac
atctcagtgattttaggaacattcatcctttacaaattattggatgcctcattttttttt
tttaactgggggagggggcttgctggtgtcttcagcagtatttttgtgtttgcggagcag
CTTTTGGAATGGATTCGTCGCACGATCCCCTGGCTGGAGAACCGGACTCCCGAGAAGACC
ATGCAAGCCATGCAGAAGAAGCTGGAGGACTTCCGGGATTACCGCCGGAAGCACAAGCCA
CCCAAGGTGCAGGAGAAATGCCAGCTGGAGATCAACTTCAACACGCTGCAGACCAAGCTG
CGGATCAGCAACCGTCCTGCCTTCATGCCCTCCGAGGGCAAGATGGTGTCG
gtgagtagcaagcgccaagccctcctggcgccacgggaagccctccttctagcctaaagg
cgtttgacctgggtcaggaggaggcattgacttcttgaatctttttagttgtgtgaatat
cattttggccctgtaaccactttgttcttaatacttttctcccaaccatcatgtacttct

 1.11 Intr +  57589  57736  148  0  1   62  115   143 0.950  14.21
agacatttggaagccaaataattgaatggttattgaggtggggggtaaggaaggaaaaga
aaacaaaaggaaaacaccatcaaaatgtagtggagggatttatagaagaagcctgagagg
ccagaatgtaacgaaggtgcttgttacacatttgcttcccttggcttccaaccatcccag
GATATTGCTGGTGCCTGGCAGAGGCTGGAGCAGGCTGAGAAGGGTTACGAGGAGTGGTTG
CTCAATGAGATTCGGAGACTGGAGCGCTTGGAACACCTGGCTGAGAAGTTCAGGCAGAAG
GCCTCAACGCACGAGACTTGGGCTTATG
gtaagtagacaggagtcagattggatttttgaaaaaccagagttgagccatgcccagagc
catgatgcatccttactaactctgtgcctaatgtctgtgacactaaaggtaggtgtcgtc
acctttctctgctcttgtctcagtgccaaatttatttaagaggtaggcatgaaaatttag

 1.12 Intr +  59319  59469  151  1  1   79   55   325 0.739  27.52
catcctcagcaggtaacagcctgaattccatcacaaccctggcctgcatcttcagtcctg
cccctctctgtccccttctcttggttctttggaatctcaccgctccctgagaatgtggct
ggcatgaggaagccgctgtgccctcagcatattcatactttcttgctaccacctttgcag
GCAAAGAGCAGATCTTGCTGCAGAAGGATTACGAGTCGGCGTCGCTGACAGAGGTGCGGG
CTCTGCTGCGGAAGCACGAGGCGTTCGAGAGCGACCTGGCAGCGCACCAGGACCGCGTGG
AGCAGATCGCAGCCATCGCGCAGGAGCTCAA
gtatgtgcagatgccctccgtcctcccgggagcccctgggattccacagagaggggagag
aaaggcctgccttgcctttcctgactaaacgcagagggaaccacgctggaggcactctgt
gcagggattctccttgtttctttaaatgtagaaacagattttggttcttagattgtggta

 1.13 Intr +  62360  62468  109  2  1   66   57   103 0.995   5.29
ccttccaccccctcacccttctgagcctccactgtctatcagcccactctctatgtccat
gtggatacatttcagatgtttttgtttttaaacttccctgttatttttcttttttagccc
atgttcattttctctcatcatctgggaaagttaatctttatttattttcacttttaatag
TGAACTGGACTATCACGACGCTGTGAATGTCAATGATCGGTGCCAGAAAATTTGTGACCA
GTGGGACCGACTGGGAACGCTTACTCAGAAGAGGAGAGAAGCCCTAGAG
gtgaagtattgaagccacttgttgacatgaaatcttttaatagaagctctttaattaaat
cactggtattcattgtgtgtttctctgtggcatgaaacaggttgcctagtgaaaggaacc
tctaaagaaaacatgaaaagtggaagaaagagggaaatgggaagttgggagctttgtgct

 1.14 Intr +  63817  63957  141  0  0  104   95   171 0.648  19.95
acctcagagacctgcagggctcagcctaattgtttgagcatcgggtaatcttttgtagac
acatgctaatacgattaacagaatatcagagaatagtctgttcttatggaacgcctactt
acactttcagtgaattttttaattagtctatgataatgcttgcttctctttattctttag
AGAATGGAGAAATTGCTAGAAACCATTGATCAGCTTCACCTGGAGTTTGCCAAGAGGGCT
GCTCCTTTCAACAATTGGATGGAGGGCGCTATGGAGGATCTGCAAGATATGTTCATTGTC
CACAGCATTGAGGAGATCCAG
gtaatggaaccgcaactctgtatgccctatgcattagaagtgagttgtcatttaaactta
agagtcctgttatttggtttcttgttttcttgctttaaaaaaaaattaacaaatgtggct
agaaagcccaaattacccttgaaccttagcttaaaaatgtgtttagtactctgtgttgca

 1.15 Intr +  66163  66345  183  0  0   42   98   310 0.993  27.38
tttccaggaacttgacttctgtgtacctaaagagttttttctaaagcattcagaatgtgt
ttttctccagagactcttgcaatcatcaaggcatttacttgtgtgcggaaaggaatatca
aagcctttgaaattaacactcaagccacattgtttttctccacttgtgtctcgggtgtag
AGTCTGATCACTGCGCATGAGCAGTTCAAGGCCACGCTGCCCGAGGCGGACGGAGAGCGG
CAGTCCATCATGGCCATCCAGAACGAGGTGGAGAAGGTGATTCAGAGCTACAACATCAGA
ATCAGCTCAAGCAACCCGTACAGCACTGTCACCATGGATGAGCTCCGGACCAAGTGGGAC
AAG
gtgggtggctgagggcctggtgtgggaccagggggcattcttgaagctgacgtcgaagga
ggaagttaacgcctcggggacttagggtgacggcctcattttgcatcatgatcaggattt
tcctttatcccaaatttcacaggcaaaacgtgacaaactcttaaggacccttcagcagcg

 1.16 Intr +  68640  68774  135  2  0  100   99   228 0.999  25.86
tagtccctagactagggactcctcctccctatcctccctcttccttccccctacaccctc
ctcccttcgtttctccttctccactcccacccccaccccttggactattcccgcattctg
tggttgttcctatgagaccacagctggcctctaacccttgttgtccttgggccctgacag
GTGAAGCAACTCGTGCCCATCCGCGATCAATCCCTGCAGGAGGAGCTGGCTCGCCAGCAT
GCTAACGAGCGTCTGAGGCGCCAGTTTGCTGCCCAAGCCAATGCCATTGGGCCCTGGATC
CAGAACAAGATGGAG
gtaagccagcgccctcccaggcgctgttcacaagccttgcgataagtccctttagccacg
cagcagtgacaccgcacatgctgtggtttccagccacccactcagtcaggtgggagcacc
gttctgttatcaccccggctttatctttcagcccctggctgttggggacagtgtgcaaac

 1.17 Intr +  69712  69891  180  0  0  101   80   390 0.999  39.56
ttgttctgcgatgctacccagtccccacttcctctgagaaaagtgaaccgagtgacactg
gccgctgcctgacgctggcctagcatcccatgcagggtctggaacggcgcctcgtgccga
gctcccttagagggcacttcactctgcttctctctctgcttgctcactcgcccccctcag
GAGATTGCCCGGAGCTCCATCCAGATCACAGGAGCCCTGGAAGACCAGATGAACCAGCTG
AAGCAGTATGAGCACAACATCATCAACTATAAGAACAACATCGACAAGCTGGAGGGAGAC
CATCAGCTCATCCAGGAGGCCCTTGTCTTTGACAACAAGCACACGAACTACACGATGGAG

gtacggcagccagacaggcgtgtgccgctcacttctcacggggaccatgccacctcctca
gggtgctttcttcatgcacttgtctttctttgttcctgttaagacctacaagtatgaaag
ttagggatctttaagcctttccagtcactatttgtggaaatgcttcgtgagctatatcga

 1.18 Intr +  72179  72325  147  1  0   88   43   280 0.999  23.93
ttctcactacagaatcttgcaacagatgacaaagtagaattttttttcaagtgtggggaa
ggctatcatgagccctgcttagtaagccctttgagtcggctgtactgttatgaaagtaaa
gaggcagagttgacatgctggagagacttagaactgatctttccccttttccctcaatag
CACATTCGTGTTGGATGGGAGCTGCTGCTGACAACCATCGCCAGAACCATCAATGAGGTG
GAGACTCAGATCCTGACGAGAGATGCGAAGGGCATCACCCAGGAGCAGATGAATGAGTTC
AGAGCCTCCTTCAACCACTTTGACAGG
gtaccactctctacttatttgaagggcaatactggggacattaaacaatgtatctgaaat
aatatgcatgctctcgttttaagtcttaaggctccacaacatttacagggaaacaggata
gttaatgacaaaagaaaatagccaccaaaactaagtgtcctaagctttgatgttgctcaa

 1.19 Intr +  74417  74482   66  1  0  103   99    45 0.986   6.20
taagaaactagtttgtaacatccttgtgctggctccatccttctcgcaagtcagtggtga
catttacgaccttggcagagctcaaagtgcttctcttaccagatctttgttcagttggtc
aagtagagttgctcatcttgccctgtgctcacctgctctgtcctttgtttttgccaacag
AGGAAGAATGGCCTGATGGATCATGAGGATTTCAGAGCCTGCCTGATTTCCATGGGTTAT
GACCTG
gtaagacagaagttgaaattgtactaagatttgatattttattgaatttggatttctgtt
ataaaagatgacaagctcaaaccaaggtagtgcatttgggattggttcgttttcattata
taggataatattttttgaaggtctcactgttattatataaaaataaagtcacgaggcctg

 1.20 Intr +  75708  75866  159  2  0   57   52   326 0.998  26.08
gtagcagtaaaccttagtcacccttaaggggaatcttgtccaaagactgaagggaaacgc
aggtaataattcagttttcagacataaaggaattggcatgtcaccagggaaagaatgaaa
acggctctgttgagagttgtgtaccgttcgtgtacatgtttctttgccactttgccccag
GGTGAAGCCGAATTTGCCCGCATTATGACCCTGGTAGATCCCAACGGGCAAGGCACCGTC
ACCTTCCAATCCTTCATCGACTTCATGACTAGAGAGACGGCTGACACCGACACTGCCGAG
CAGGTCATCGCCTCCTTCCGGATCCTGGCTTCTGATAAG
gtctgcattgacagatttccttctgctttagcaggagtccactacatccttctaacaaaa
aaggcaacagtgttgtaaataaaaaccatttttatgccggtgtattttgtacaacattgg
cactgatttcagaaggcagcagatagacacacaacaatggcgcgcccagcacagaggaaa

 1.21 Term +  77154  77312  159  2  0   80   44   174 0.996  10.14
acgctcctacaagtaaaacttggctttctgttggttgtctggtactactatgccaataga
ctccctattctttagtccttttaaaaaattaaacagatgcaagaaatatgtaagtattaa
gactgtttatgttgtggtgtttctgcaactgactgcaaacacgtgtgtattttttcccag
CCATACATCCTGGCGGAGGAGCTGCGTCGGGAGCTGCCCCCGGATCAGGCCCAGTACTGC
ATCAAGAGGATGCCCGCCTACTCGGGCCCAGGCAGTGTGCCTGGTGCACTGGATTACGCT
GCGTTCTCTTCCGCACTCTACGGGGAGAGCGATCTGTGA
tgctgagcttctgtaatcactcatcccatcagaatgcaataaaagcggaagtcacagttt
gtttcctggaaactttgacaagctttattaagttgagagagagagaggggaaaaaaaaaa
gcctttcgtagttcagtaattgccagcaatataacacggctaaaatgaagtttttacagt

Predicted peptide sequence(s):


>ACTN2_1|GENSCAN_predicted_peptide_1|920_aa
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
PKYFSIVALITLTEVSFPRPFEEQNSHTLLSLNPLSPASSGLPLSMGHLELDDPIGNINL
AMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLA
VNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPK
VQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIR
RLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAH
QDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKLLETI
DQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQS
IMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHA
NERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDK
LEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQ
MNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSF
IDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGS
VPGALDYAAFSSALYGESDL